KEGG   Bacteroides zoogleoformans: C4H11_04675Help
Entry
C4H11_04675       CDS       T05371                                 

Definition
(GenBank) alpha-glucosidase
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
bzg  Bacteroides zoogleoformans
Pathway
bzg00500  Starch and sucrose metabolism
bzg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bzg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    C4H11_04675
Enzymes [BR:bzg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     C4H11_04675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C
Motif
Other DBs
NCBI-ProteinID: AVM52331
UniProt: A0A2R3MHY5
LinkDB All DBs
Position
1120584..1122746
Genome map
AA seq 720 aa AA seqDB search
MRNMKAICTRMVCFLLVLMMSSAAMAEGITSPNGQLKLNFSVNAQGEPVYELFYKGKAVI
SPSKLGLELKNDSGLMNGFTLTNASTSTFDETWQPVWGEVKHIRNHYNELVVTLNQKAQD
RNMIIRFRLFNDGLGFRYEFPLQKNLNYFIVKEERTQFAMTGDHTAFWIPGDYDTQEYDY
TESKLSEIRGLMDEAITENSSQTQFSPTGVQTSLQMKTADGLYINLHEAALVDYSCMHLN
LDDKNFVFESWLTPDAVGDKGYLQAPCTSPWRTVIVSDDARDILASKITLNLNEPCAYED
VSWIKPVKYVGVWWEMIAGKSSWAYTDNLPSIKLGETDYAKTRPNGRHGANNENVKKYID
FAARHGFDQVLVEGWNEGWEDWFGKSKDYVFDFVTPYPDFDVKMLNAYAKSKGVRLMMHH
ETSGSIRNYERHMDKAYQFMVSNGYNAVKSGYVGNMIPRGEHHYGQWLNNHYLYAVKKAA
DYKICVNAHEAVRPTGLCRTYPNLIANESARGTEYEAFGGSKPFHTTLLPFNRLIGGPMD
YTPGIFDTKLDFMGTLPHGQVQTTLAKQLALYVTLYSPLQMAADLVENYEKHMDAFQFIK
DVAVDWDDSKYIEAEPGDYITVARKAKGTGNWFVGGITDENTHTAVFTLDFLEPGKQYVA
TLYADGKDADYQTNPTSYQVKKGIVTHKTKLSVKEARSGGFALSLFEATSMDNKSLKKWK
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgagaaacatgaaagcaatctgcacaagaatggtttgcttcctgctcgttttgatgatg
agtagtgcagcaatggcagagggtatcacctctccaaacggacaactcaaactgaacttc
tcggtgaatgcgcaaggcgaaccggtttatgagcttttttataaaggaaaggccgtgatt
agcccttcaaagttgggactggaactgaaaaacgattcgggactgatgaacggttttacg
ctgacaaacgcaagtacatctacatttgatgaaacgtggcaaccggtttggggagaagtg
aaacacatccgtaaccactacaacgaattggttgtgacgcttaaccagaaagcgcaagac
agaaatatgattatccgtttccgattgtttaacgatggtctcggctttcgctatgaattt
cctttgcagaagaatctgaattattttatcgtcaaagaagagcgtacacagtttgccatg
accggtgaccatacggctttttggattccgggcgactatgatacacaggaatacgactac
acagagtccaaactctccgagattcgcgggttgatggacgaggccattaccgagaactct
tcgcaaacgcagttttctcctaccggcgttcagacctccttacagatgaaaacagccgat
ggcttgtacatcaatctccatgaggcggctttggtagattattcttgcatgcacctgaat
ctggatgacaagaactttgtgtttgagtcttggctgacacctgatgccgtaggagacaaa
ggttatctgcaagcgccttgtacttcgccgtggcgcacggtgattgtcagcgatgacgcc
cgtgatattcttgcgtctaaaatcacactgaacctgaatgagccttgcgcttatgaagac
gtttcgtggataaaaccggtgaagtacgtaggcgtatggtgggaaatgattgccggcaaa
agttcttgggcatacacggacaacctgccttctataaaattgggcgaaacggattatgcg
aagacccgaccaaacggacgccatggagccaacaatgagaatgtcaagaagtacattgat
tttgcagccaggcatggcttcgaccaagtattggtagaaggctggaatgaaggttgggaa
gactggttcggcaaatcgaaagactacgtgttcgactttgtaactccttatcctgatttt
gacgtcaagatgctgaatgcctatgccaagagcaaaggcgtaagattgatgatgcaccac
gaaacttccggttccatacgaaactacgaacgacatatggacaaagcttatcaattcatg
gtgagcaatggctacaatgccgtgaagagtggatacgtgggaaatatgattccccgcgga
gaacatcattacggccagtggcttaacaatcactacctctatgctgtgaagaaagcggcc
gactataaaatttgcgtcaatgctcatgaggctgtgcgccccaccggtttgtgccgcaca
tatcccaacctgattgccaatgagtcggcgcgcggtactgaatacgaagcatttggcggc
agtaaaccgttccacaccacattgttacctttcaaccgtctgattggcggcccgatggac
tacacgccgggcatattcgacacgaaactcgactttatgggtactctgcctcatgggcaa
gtgcagaccacccttgccaaacagttggctctttatgtcaccctctacagtccgttgcag
atggctgccgacttggtggagaactacgaaaagcacatggatgctttccaattcatcaaa
gacgttgcggtagattgggatgacagcaagtacatagaggcagaaccgggtgattacatc
accgtggctcgtaaagcaaaaggcaccggcaattggtttgtgggcggcatcacggatgag
aatacgcataccgctgtctttacactcgatttcttggagccgggcaaacaatatgtggct
actctctatgccgacggcaaagatgcagactaccaaacaaaccccacctcttatcaagtc
aaaaaaggtattgtaacccataagaccaagctatctgtgaaggaagcacgcagcggcggt
tttgccctcagtctgtttgaagcaacttccatggataataagtcactgaagaaatggaaa
taa

DBGET integrated database retrieval system