KEGG   Bacteroides zoogleoformans: C4H11_06510Help
Entry
C4H11_06510       CDS       T05371                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
bzg  Bacteroides zoogleoformans
Pathway
bzg00240  Pyrimidine metabolism
bzg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bzg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    C4H11_06510
Enzymes [BR:bzg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     C4H11_06510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK FUR
Motif
Other DBs
NCBI-ProteinID: AVM52633
UniProt: A0A2R3MIY4
LinkDB All DBs
Position
1521984..1522589
Genome map
AA seq 201 aa AA seqDB search
MVVFSEDHIQETRRRGRIEVICGSMFSGKTEELIRRLKRAKFAKQRVEIFKPAIDTRYSE
ADVVSHDSHSISSTPIDSSASILLFTSEIDVVGIDEAQFFDAGLIDVCNQLANNGIRVIV
AGLDMDFRGVPFGPMPGLCAIADEVSKVHAICVKCGRLASFSHRTVKNDKQVLLGETAEY
EPLCRECYLRAIRTDRLAPHE
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggtagtattctcagaagaccacatacaagagaccagacgcagaggaagaatcgaagtc
atttgcggttcgatgttctccggcaaaacggaagaattgatacgacgcctcaaaagggcc
aagtttgccaaacagcgtgtagagatattcaaaccggccatagacactcgctattccgag
gccgatgttgtgtctcacgacagtcattccatctcctctactcccatagattcatcggca
agtattttattgttcacgtcagaaattgatgtggtcggcattgatgaggcccaatttttc
gatgccggattgattgatgtatgcaatcagcttgccaacaacggcatacgtgtcattgtt
gccggattggatatggattttcgcggtgtgccgttcggcccgatgccgggattgtgtgcc
attgccgacgaagtgtccaaggtgcatgccatctgtgtaaaatgcggccggttagcctct
ttctcgcaccgcacagtgaaaaacgacaagcaagtattgctcggcgaaacggccgaatac
gagcccttgtgccgcgaatgttacctgcgagctatccgaacagaccggctggcgcctcat
gaataa

DBGET integrated database retrieval system