KEGG   Bacteroides zoogleoformans: C4H11_07740Help
Entry
C4H11_07740       CDS       T05371                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bzg  Bacteroides zoogleoformans
Brite
KEGG Orthology (KO) [BR:bzg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C4H11_07740 (ahpF)
Enzymes [BR:bzg01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     C4H11_07740 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like Thioredoxin_3 FAD_oxidored FAD_binding_2 DAO AlaDh_PNT_C NAD_binding_8 Thi4 Glutaredoxin K_oxygenase FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AVM52839
UniProt: A0A562VL32
LinkDB All DBs
Position
1843283..1844857
Genome map
AA seq 524 aa AA seqDB search
MLDTTTLEQVRSVFRHLQSRYVFHISYSPKHEQSREVIDFLNDVAGCSDKLSCLPVETDS
LVAEFTLQKEGAETGIKFRGIPGGHEFTSLLLAVLNADGKGKNLPDEVITRRIKALKGPI
RLQTYVSLTCTNCPDVVQALNIIALLNPNVTHEMVDGDAYQEEVNALKIQAVPSVYANGK
PLHVGRGSLGQLLQKLEEAFGSLPQADAAPVERAFDTIVLGGGPAGASAAIYSARKGLRV
AIVAERIGGQVKETVGIENLISVPQTTGAQLADALRNHIGHYPIELFEDRQIEKAELQGK
TKRISAAGGETFIAPAVIIATGASWRKLNVEGEAEYIGRGVAFCPHCDGPFYQGKHVAVI
GGGNSGIEAAIDLAGICRKVTVFEFADTLKADQVLQAKAQSLPNVEIFTSSQTTKVVGNG
EKVTAIRIKDRLTNEERDFPLDGIFVQIGLSANSAPFRDALETTPIGEIKIDAFCRTSLP
GVYAAGDVSSVPYKQIVIAMGEGAKAALSAFDDRIRGVDSIIKS
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgttagatacaacaactttagaacaagtgcggagcgtattccggcatttgcaatcccgc
tacgtctttcatatcagttattcgccgaagcacgagcagagtcgggaagttatcgacttc
ctgaatgatgtggccggctgctccgataaactctcctgtctacctgtcgagacagattca
cttgtggccgaattcaccttgcagaaagaaggagcggaaacgggcatcaagttccgtggc
ataccgggcggacacgagtttacctccctcctgctggctgtgctgaacgccgacggaaaa
ggcaaaaacctgccggatgaggtcatcacccgccgcatcaaagccttgaaaggccccatt
cgcttgcaaacttacgtctcactgacgtgtacaaactgtcccgacgtagtgcaagcgctt
aatatcattgccttattgaacccgaatgtgacgcacgagatggtggacggcgatgcttat
caagaggaagtgaacgcattgaagatacaagccgtgccgtcagtctatgccaacggaaag
cctttgcatgtgggacgcggctctttaggtcaactgttgcagaagctggaagaggctttc
gggagtttgccgcaagcggatgcagcccctgtcgagagggcattcgatacgattgtactc
ggcggaggtcctgccggagcttcggcagccatctactctgcccgcaaggggctgcgtgtg
gcgatcgttgccgaacggataggcggacaggtgaaagagaccgtaggcatcgaaaacctg
atttccgtgccgcaaaccacgggcgcacaactggccgatgcactcagaaaccacatcggg
cactatccgatagaactgtttgaagaccggcagatagaaaaagcggagttgcaaggcaag
acgaaacgcatctcagcagcgggtggtgaaacattcatcgctcctgcggtaatcattgcc
acaggtgcaagctggcgcaaactgaatgtggagggcgaagccgaatacatcggccgcggc
gtggctttctgtccgcattgcgacggaccgttctaccaaggcaaacacgtagccgtgatt
ggcggaggcaactccggcatagaagcggccatcgacttggcaggtatctgccggaaagtc
accgtattcgagtttgccgatacgctgaaggccgaccaggtgctccaagcaaaagcccaa
agcctgccgaacgtggaaatcttcacctcctcgcagaccacgaaagtggtgggcaacggc
gaaaaggtgacagccatccgcatcaaagaccgccttacgaacgaagaacgtgacttccct
ctggatggcatcttcgtgcagataggcctctcggccaatagtgcccctttccgcgacgca
ttggagaccactcccatcggagaaatcaagatagatgccttttgtcgtacctcgcttccg
ggtgtttatgccgccggagacgtgtcgagcgtgccctataaacagattgtcatcgccatg
ggcgaaggagccaaagcggcgctttcggcgttcgacgaccgtatccggggtgtagattca
atcataaaatcttga

DBGET integrated database retrieval system