KEGG   Bacteroides zoogleoformans: C4H11_13035Help
Entry
C4H11_13035       CDS       T05371                                 

Definition
(GenBank) bifunctional UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase/alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bzg  Bacteroides zoogleoformans
Pathway
bzg00473  D-Alanine metabolism
bzg01100  Metabolic pathways
bzg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bzg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    C4H11_13035
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    C4H11_13035
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bzg01011]
    C4H11_13035
Enzymes [BR:bzg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     C4H11_13035
Peptidoglycan biosynthesis and degradation proteins [BR:bzg01011]
 Precursor biosynthesis
  Racemase
   C4H11_13035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: AVM53710
UniProt: A0A2R3MLS0
LinkDB All DBs
Position
3110258..3112738
Genome map
AA seq 826 aa AA seqDB search
MSYSIESITESIGARRVGNAPAAIDWLLTDSRSLNFPEETLFFALTTKRNDGARYVADLY
ARGVRNFVIGESSFEQIGEDRPADANFLVVSNPLKALQKLAERHRSRFRIPVVGITGSNG
KTIVKEWLHQLLSPERAIVRSPRSYNSQIGVPLSVWQMNEQSELAIFEAGISEPGEMRTL
QNIIRPTIGILTNIGGAHQENFFSLQEKCMEKLQLFKDCDVVIYNGDDEFISNCVARSML
SAREIAWSRKDMERPLYISMVEKRENCTVISYRYLDMDNTFTLPFIDDAAIENSLNCLAA
CLYLMLPAELITERMAKLEPVAMRLEVKEGKNNCLLINDSYNSDLGSLDIALDFLYRRSL
SKGLKRTLILSDILETGQNASTLYRQVAQLVGSRGIERIIGVGSEISSCAARFSMEKAFY
PDTATLMSVIAQGELPLENEIILIKGARKFGFDALTEMLEKKVHETILEVNLGAMIANLN
HYRGKLKPETKMVCMVKASAYGAGSYEIAKTLQEHRVDYLAVAVADEGSELRKAGITANI
IIMNPEMTAFKTMFDHKLEPEVYSFHLLDALIKEAEKEGITHFPVHIKLDTGMHRLGFAP
SDIPRLIERLKGQNAVIARSVFSHLVGSDSPQFDAFTRRQIETFESASACLQEAFPHKIL
RHICNSAGIERFPGAQFDMVRLGIGLYGISPIDNSILNNVSTLKTTILQIREVAREDTVG
YSRKGRLTRPSRIAAIPIGYADGLNRHLGNGNAYCLVNGKRAAYVGNICMDVCMIDVTDI
DCKEGDSVEVFGDRLPITVLSDVLGTIPYEVLTGVSTRVKRVYYQD
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atgtcatactcgattgaaagcataaccgaaagcatcggtgcgcggcgtgtggggaatgcg
ccggccgccatagactggctgcttaccgacagccgttccttgaatttccccgaagaaaca
ctattctttgcgctgactacgaaacggaacgacggcgcccgttatgtcgcggacttgtat
gcccgtggggtgcgtaatttcgtcatcggagaaagcagctttgaacaaataggagaagac
cggccggcagatgccaacttcttggtggtctccaacccattgaaagcattgcaaaagctg
gcggaacgacaccggagccgcttccgcattcccgtcgtcggcatcaccggaagtaacggc
aagaccattgtaaaagaatggctgcatcagttgctcagtcccgaacgcgccattgtgcgc
tcgccccgcagctacaattcccagataggggtacccttgtccgtatggcagatgaacgag
cagtcggagcttgccatcttcgaggccggcatatccgaaccgggagaaatgcgcacgttg
caaaacatcatcagacccaccatcggcatcctgaccaatataggaggcgctcatcaagag
aactttttctctttgcaggagaagtgtatggagaaactacagcttttcaaagattgcgat
gtggtgatttataatggggatgacgagttcatcagcaactgtgtggccaggtccatgctg
tctgcgcgtgagattgcatggagccggaaagacatggagcgccccctctatataagcatg
gtggaaaagcgggaaaactgcaccgtcatctcttaccgctatctggacatggacaatacg
tttacattgccgtttatcgatgatgccgccattgagaattcgctgaactgcctggcggcc
tgtctttatctgatgcttcccgccgaactgataacggagcgtatggcgaaattggagccc
gtggccatgcgtctggaggtgaaggaggggaagaacaactgcctgctgattaacgatagc
tacaattcagacctcggctcgctggacattgccctcgatttcctttaccgccgctcgctt
tccaaaggcttgaaacgaacgttgattctttctgatatcctggagaccgggcagaacgcc
tccaccctttaccggcaggtggcgcagctggtcggcagccggggcatcgaacgcatcatc
ggcgtgggcagcgagatatcttcgtgtgccgctcgttttagcatggagaaagccttttat
cccgacacggccacgctgatgagtgtgattgcgcagggcgaactgcctcttgagaatgag
ataatcttgataaagggcgcgcgcaagttcggctttgacgccttgacggaaatgctcgag
aagaaagtgcacgagacgatactggaggtcaatcttggtgccatgatagccaatctgaac
cattaccgcggcaagctgaagcccgaaaccaaaatggtgtgtatggtgaaagcttcggcc
tatggcgccgggtcttacgaaatagccaagacgttgcaagagcatcgtgtggattacctt
gccgtggcggtggccgatgaaggttcggaactgcgtaaggcaggcatcacggccaacatc
atcatcatgaatccggaaatgaccgctttcaagaccatgttcgaccataagctggagccc
gaggtgtatagcttccatctgctggacgcattgataaaggaggcggagaaagaaggcata
acccatttcccggttcacatcaagctggacacggggatgcaccggttgggcttcgctccg
tcggatatcccccggctgattgaaagactgaaagggcagaacgccgtcattgcccgttcc
gttttctcccatcttgtagggagcgactcgccgcagttcgacgccttcacgcgccggcag
atcgagaccttcgagtcggcttcggcctgcctgcaggaagccttcccgcataagatactc
cggcacatctgcaattcggccggcatcgaacgcttccccggagcgcagttcgacatggtg
cgtctgggcatcggcctctatggcatcagccccatcgataactccatcctgaacaatgtc
agcacgctcaagactaccatcctgcagatacgcgaggtggcccgggaagacaccgtgggc
tatagccggaaagggcgcctgacgcgtccgtcgcgcatcgctgccatccccatcggttac
gccgacggcctgaaccgccatttgggcaacggcaatgcctattgcctggtgaacggcaag
cgggcggcgtatgtgggcaatatctgcatggatgtctgcatgattgacgtgaccgacatc
gactgtaaggagggcgacagcgtggaagtcttcggcgaccgcctgccgataacggtcctc
tcggacgtgctcggcaccattccttatgaagtgctgaccggtgtttccacacgggtgaag
agagtctattaccaagattaa

DBGET integrated database retrieval system