KEGG   Coraliomargarita akajimensis: Caka_0224Help
Entry
Caka_0224         CDS       T01204                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
Organism
caa  Coraliomargarita akajimensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 Pyr_redox AdoHcyase_NAD HI0933_like Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: ADE53251
UniProt: D5ELS6
LinkDB All DBs
Position
287453..288469
Genome map
AA seq 338 aa AA seqDB search
MKAVYYNGNADFTVGNCEPAAPAAGEIRLNVAYCGVCGTDIHIAHGAMDARVPSPMVIGH
EMSGTVAELGEGVEGFDVGDKVVVRPLDNRGETPADRGYSHICQDLKFIGIDAPGAFQAS
WTVPAFTVHKLPADIDLKLAALVEPLAVACHDVRLGAVKEGELAFVLGGGPIGMLVALVA
KAAGARVVVSEISPFRLEFAKSLGLEVVNPMETDLAEWAKEQSGGSGADVVFEVSGAKPA
AASMTKLLAIRGRIVVVAIYPQPVEINLFDFFWKELSMSGARVYEPEDYEKAIELIAGGE
VPFDKLISQVEPLENLPEVFKQLDSNPEAMKVLIDCQS
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgtttattataatggaaatgccgacttcacggtcggaaactgcgagccagcc
gcacctgctgctggtgaaattcgcctgaacgtcgcctattgcggtgtctgtggtactgat
attcacatcgcgcatggtgcgatggatgcacgtgttccatcgccgatggtgatcggtcac
gagatgtccggcactgttgctgaattgggtgagggtgttgaaggcttcgacgttggcgac
aaggttgtggtgcgtccgctcgacaaccgcggtgaaacacctgctgaccgtggttacagc
cacatctgtcaggacctcaagttcatcggcatcgacgcacccggtgcgttccaggcctct
tggaccgttccagcctttaccgttcacaagcttccggctgacatcgatttgaagctggct
gcactggttgagccacttgcagttgcctgtcacgatgtgcgtctcggcgcagtgaaggag
ggcgaactggcctttgttcttggtggtggaccaattggtatgctggttgccctagtggcc
aaggctgcgggtgcccgcgtggtggtttctgaaatcagccccttccgcttggagttcgcg
aagtcccttgggcttgaggtggtgaacccaatggaaaccgatctcgctgaatgggcgaag
gaacaaagtggtggcagtggcgcggacgtcgtgtttgaagtgtccggtgccaagcctgcg
gcagcatccatgaccaagctgctggcgatccgtggacggatcgtggtggttgcgatctat
ccgcaaccggttgaaatcaaccttttcgatttcttctggaaggaactctccatgagtggt
gcgcgtgtgtacgagccggaagattacgagaaggcaattgagctgattgctggaggcgaa
gtgccattcgataagttgatctcccaagtcgagccactcgaaaacttgcccgaagtcttc
aaacagttggatagcaatccggaggcgatgaaggttctcatcgattgccaatcctaa

DBGET integrated database retrieval system