KEGG   Coraliomargarita akajimensis: Caka_3074Help
Entry
Caka_3074         CDS       T01204                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
caa  Coraliomargarita akajimensis
Pathway
caa00473  D-Alanine metabolism
caa00550  Peptidoglycan biosynthesis
caa01100  Metabolic pathways
caa01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:caa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Caka_3074
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Caka_3074
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Caka_3074
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:caa01011]
    Caka_3074
Enzymes [BR:caa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Caka_3074
Peptidoglycan biosynthesis and degradation proteins [BR:caa01011]
 Precursor biosynthesis
  Amino acid ligase
   Caka_3074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 ATPgrasp_ST TTL CPSase_L_D2 RimK
Motif
Other DBs
NCBI-ProteinID: ADE56087
UniProt: D5EI47
LinkDB All DBs
Position
3690480..3691397
Genome map
AA seq 305 aa AA seqDB search
MQELKVIVMYGGVGTEREVSLNSGDAIAAALEANFPVERLRLDSAELPGTIDAATSIVFP
ALHGSFGEDGQLQALMDAAGIEYCGSGAAASRLCMDKSRTKELARELNIRVPEAVTFSGT
AVPLADALIDQLGSSLVIKPTDQGSSVGLFFTEHRSELGVTLSQIHQGNWLAEQRIRGRE
LTVGVLHGKAMGVVEIISSSGVYDYAAKYTPGSTEYRFPAELEASVTAQIQQQAEQIYAA
CDCRDFARIDFLLDGNAPYFLEVNTLPGLTATSLLPKSAACVGYDFESLARQLVSAAIER
KEAGA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcaggagcttaaggtcattgtcatgtacggtggggtcggcaccgaacgcgaggtttca
ctcaacagtggtgacgccattgcagcagcgcttgaagcgaactttccagtagagcgcttg
cgtttggattcggcagaactaccgggcacgatcgacgcggcgacctccattgtgtttccg
gccctgcacggcagctttggtgaagacggccaactccaggcgctcatggacgccgccggt
atcgagtactgtggcagcggtgccgcagcaagccgtctgtgcatggacaagagccgaacc
aaggaactggctcgtgagttgaacattcgtgtcccggaagcggtgaccttctccggcaca
gcggttcccttggcagatgccttgatcgatcaactgggaagctctctagtgattaagcca
accgatcagggtagtagcgtggggcttttttttaccgagcaccgctccgagctgggagtg
acgctttcgcagattcaccaaggtaactggctggctgaacagcgtatccgcgggcgcgaa
ttgaccgttggcgtactccatggcaaggcgatgggcgtagtcgaaattatcagttcgagc
ggggtttatgactatgctgcgaagtatacgccgggttcgactgagtatcggtttccggca
gaattggaggcaagtgtgaccgcccagattcagcagcaggccgagcaaatctatgctgcc
tgtgactgtcgtgattttgcgcgaattgacttccttctggatggaaatgcgccttatttc
ttggaagtgaatacactacccggactaactgcgacgagcttgctaccaaagagcgcggct
tgtgtcggctacgattttgagtcgttggcccgacagttggtgtctgcggccatcgaacga
aaggaggctggcgcttga

DBGET integrated database retrieval system