KEGG   Caballeronia sp. SBC2: SBC2_40490
Entry
SBC2_40490        CDS       T06459                                 

Gene name
pal_5
Definition
(GenBank) Peptidoglycan-associated lipoprotein
  KO
K11892  type VI secretion system protein ImpK
Organism
caba  Caballeronia sp. SBC2
Pathway
caba03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:caba00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SBC2_40490 (pal_5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:caba02044]
    SBC2_40490 (pal_5)
Secretion system [BR:caba02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SBC2_40490 (pal_5)
SSDB
Motif
Pfam: DotU OmpA
Other DBs
NCBI-ProteinID: QIE25979
LinkDB
Position
pSBC2-1:complement(474873..476195)
AA seq 440 aa
MATSPDWNSTEPRDARKGVPTAELAKNDDKVAEHETGEALSESLELPAPENPAQRLVAIR
VAQNPLLEASRVLLRALADMPDTLESQSAVEALRVALEQEVRIFQSLCEQANIRRDHMLG
ARYCLCTALDEAAMQTTWASDGKSSLGKWNTDGLATTFHEDRNGGDKVYYLIGRLMTEPK
EHLDLLEVIYRVLSLGFEGRYRHITDGRRQHDAVRQRLYTEIMSQRGPVPVPLSPHWQGD
TSGHSRPFYDFPVWISVVVLSVILLGFYGYAKYELMTRSAAIERKIAEIGHMTPPPAPPT
LHLTELLKNEIAAGKVSVDEDEHHSAVTFHGDDMFVAGNASINPSMQPLVAKIAAEIIKV
PGKVTVIGHTDNTPIRGRAFTSNQALSEERATQVMQLLQNAGVPASRLEAIGKGDTAPIA
DDKTFQGRAQNRRVEINVAE
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggcaacgtcgccggattggaatagtacagagccccgggatgctcgcaaaggtgtgcct
acagccgagttagcaaaaaacgatgacaaggtcgcagagcatgaaaccggggaagctttg
agcgagtcattggaactgcccgcgccggaaaaccctgcacaacgcctcgttgcgatccgt
gtggcccagaatccgcttctcgaagcgtcgcgtgtactgttgcgcgcgcttgccgatatg
ccggacacgcttgagtctcagagtgccgtcgaggcgctgcgagtcgcgcttgaacaggaa
gtacgcatcttccagagtttgtgcgaacaggccaacatccggcgcgaccacatgcttggc
gcacgttattgcttgtgcaccgcgctcgacgaggcggcgatgcaaacgacttgggcaagc
gacggcaaaagcagcctcggcaagtggaacacggatggattggcaaccaccttccacgaa
gaccgcaacggtggcgacaaagtctattacttaattggccgcttgatgaccgagccgaag
gagcacctcgacttgctcgaagtgatctaccgggttctgagccttggctttgaggggcgt
tatcgtcacattaccgacgggcgccgccagcacgacgccgtgcgtcagcggctctacaca
gaaatcatgtctcagcgcggccccgtgccggtgccgctctcgccgcactggcaaggcgac
acaagtggtcacagtcgaccgttctacgactttcccgtgtggatctcagtggtcgtgctt
tcggtgatcctgcttgggttttatggctatgcgaaatacgaactgatgacgcgcagcgcc
gcgattgagagaaagatcgccgagatcggccacatgacgcccccgcccgctccgcctacg
ctgcacctaacggaactgctcaagaacgaaattgccgccggcaaggtcagcgtcgatgaa
gatgaacatcacagtgcggtgacattccacggcgacgatatgtttgtggcgggtaacgca
tcgatcaacccatcaatgcaaccactcgtcgccaagatcgcagccgaaatcatcaaggtg
ccgggcaaggtcaccgtgatcggtcacaccgacaacacgcctattcgtggtcgcgcgttc
acgtcgaaccaggcactgtcggaagagcgtgccactcaggtcatgcagttgctgcagaac
gcaggagtgccagcgagccgccttgaagcgattggcaagggtgatacggcgccaatcgca
gacgacaagacgttccaagggcgtgcgcaaaaccggcgcgtcgaaatcaacgtcgcagag
tga

DBGET integrated database retrieval system