KEGG   Chlamydia abortus: AB7_3751Help
Entry
AB7_3751          CDS       T03773                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cabo  Chlamydia abortus
Brite
Enzymes [BR:cabo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AB7_3751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_N Sod_Fe_C Imm3
Motif
Other DBs
NCBI-ProteinID: CED80391
UniProt: A0A1X6VSK3
LinkDB All DBs
Position
1:390432..391055
Genome map
AA seq 207 aa AA seqDB search
MTFVPYTLPPLPYDYSALEPVISAEIMHLHHQKHHQGYINNLNEALKKLDLADVQQDLTQ
LIALEPTIRFNGGGHINHSLFWEMLAPIGQGGGVPPKHGLLKLIEKFWGTFDNFLKEFIK
FAAPIQGSGWAWLGFCPEKQELTLHATVNQDPLEATTGKVPLLGVDVWEHAYYLQYKNVR
LDYLKAIPQVINWGYIEKRFSEITKDN
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgacctttgttccctatactttgcccccattgccctatgattattctgctctagagcca
gtaattagtgctgagattatgcatctacatcatcaaaagcatcatcaaggttatataaat
aatttgaatgaagctttgaagaagttagatctagctgatgtacaacaagaccttacgcag
ttgattgctttagagcctactatacgatttaatgggggagggcatattaaccactcctta
ttttgggaaatgctcgctccgataggtcaaggtggaggcgtccctcctaagcacggctta
cttaagcttattgagaaattctggggaacttttgacaactttttaaaagaatttattaaa
tttgccgccccgattcagggttccgggtgggcttggctaggtttttgtcccgaaaaacaa
gaacttacgctacacgcgacagtaaaccaggatcctctcgaagccaccacaggtaaggtg
cctcttctcggagtcgacgtctgggagcatgcgtattacctccaatataaaaatgttaga
ttagattacttaaaagcaattcctcaagtaattaattggggatatattgaaaaaagattt
tctgagataactaaagataactaa

DBGET integrated database retrieval system