KEGG   Chlamydia abortus: AB7_9131Help
Entry
AB7_9131          CDS       T03773                                 

Definition
(GenBank) putative bifunctional cell division-related protein (includes: UDP-N-acetylmuramate--L-alanine ligase and D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
cabo  Chlamydia abortus
Pathway
cabo00471  D-Glutamine and D-glutamate metabolism
cabo00550  Peptidoglycan biosynthesis
cabo01100  Metabolic pathways
cabo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cabo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    AB7_9131
   00473 D-Alanine metabolism
    AB7_9131
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AB7_9131
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AB7_9131
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cabo01011]
    AB7_9131
Enzymes [BR:cabo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AB7_9131
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     AB7_9131
Peptidoglycan biosynthesis and degradation proteins [BR:cabo01011]
 Precursor biosynthesis
  Amino acid ligase
   AB7_9131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N Mur_ligase Mur_ligase_M Mur_ligase_C CPSase_L_D2 ATP-grasp ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: CED80875
UniProt: A0A1X6VUN4
LinkDB All DBs
Position
1:complement(957146..959578)
Genome map
AA seq 810 aa AA seqDB search
MDRKIHYHFIGIGGIGMSALAHILLDRGYSVSGSDVNRGPIVDKLVAKGARYLQGHKKNH
IPEDCTIVYGSGIAKDNVEYIEAVRKQLPMLHRSELLAFLMQEQTSILVSGSHGKTTVSS
LITAIFQTAKKDPSYAIGGLNSLSLNGYSGSSEYFIAEADESDGSLKHYLPKVAVVTNLD
NEHLSNFEGSKEKLASTIEEFTRKVENPRLCFYNGDCQELKGRISGTSYGFSQDCHLRIY
SYSQNGWRSLFSLSFLGKDYLDIDLNLIGKHNIANAAVAMGIALTLGIDEESIREALKNF
AGIQRRMERKNISEKFLFFEDYAHHPSEISCTLRGLRDAVGLRRIVAICQPHRFSRLQYC
LEDFYKAFQDADEVILTDVYSAGETALDLPSPEKLAETISLASHVRCRYLPYDDILPYLQ
QEIRVHDVCISLGAGNIYAVGNALKDFEPKKLSVGVVCGGKSCEHDISVLSAKNVVRYLS
PEYYDIQYFIIDRQGLWSKVSTIACEDYEGKGYHVLSSEITEALIHLDFILPILHGPFGE
DGTLQGFLEIINQPYAGPSLLFSSVTMDKIMTKRLAASVGVPVVPYQPLTLHAWKRTPEL
CMHKIAEAFTFPMFVKTAHLGSSIGVFEVHNEEELKAKISEAFLYDTDIFIEESRLGSRE
IEVSCLGDSSSCYYISEPHERCGEKRFISYEDKYGLNGRTSAQIQYDLDLSEELKIRVKE
LTERMYRVIQGQGSCRVDFFLDDEGNFWLSEMNPIPGMTKASPFLHDFVRLGWTFEQVIH
QLIISGLHKFDQKKKVGRTLNKQCLVTAKS
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atggataggaaaatccattatcattttatcggtatcggtggaataggaatgagtgcatta
gctcatattttattagaccgaggatattccgtatcaggaagtgatgtaaatcgaggaccc
attgtcgataagcttgtggctaaaggggcacggtatttgcaaggacataagaaaaatcat
attcctgaagattgcactatcgtttatggatcggggattgctaaggataatgtagaatat
atagaagctgtaagaaaacagctacccatgctccatcgctctgaacttctcgcttttttg
atgcaagaacaaacaagtattttagtttcagggagtcatggcaaaactacagtgtcttca
ttaatcacagccattttccaaacagcaaaaaaagatccctcctatgcgattggaggcctg
aattctctatccttgaatggttattcaggaagttcagagtactttatagcagaagctgat
gaaagtgacggatctttaaaacactatcttcctaaagttgccgttgtaaccaatttagat
aatgaacatctcagtaatttcgaagggagtaaggaaaagcttgcttcaacaattgaagaa
tttacccgtaaggttgaaaatccacgtttatgcttttataatggcgactgccaagaacta
aaaggaagaatctcaggaacatcttatggattttctcaagattgtcacttacgtatatat
tcctattctcagaatggctggcgctcgctattttctctgtctttcttagggaaagattac
ctagacatagatcttaacctcatcggcaagcacaacattgcaaacgctgctgtcgccatg
ggtatagcattaactttaggcattgatgaagaaagtattcgcgaggctcttaagaacttt
gccggtattcaaagacgtatggaaagaaagaatatttccgagaaattcttattctttgaa
gactatgcacaccatccttctgaaatctcttgcactctcagaggattacgagatgctgtt
ggcttgcgtcgtatagttgccatatgccaaccacatagattttctagattgcaatattgc
ttggaagatttttataaagctttccaagatgctgatgaggtaattcttactgatgtctac
agtgctggagaaactgcattagatttaccttctcctgagaaattagcagagacgatttcc
ttagcctctcatgtacgttgtcgctatcttccctatgatgacattcttccctatctccaa
caagaaatacgcgttcatgatgtctgtatatctttaggagcaggaaatatttatgctgta
ggcaacgctttaaaggattttgaacctaagaaactttccgttggagtagtctgtggaggg
aagtcttgcgaacacgatatttccgtattgtctgcgaaaaatgtcgttcggtatttgtct
cccgaatactacgatatacaatactttattatcgatcgtcagggattatggtccaaggtc
tcgactattgcatgcgaagattatgaaggaaaaggttatcatgtcttatcttcagagatc
acagaggctcttatacatttagattttatccttccgatattacatggcccctttggagaa
gacggtacgcttcaaggattcttagaaattatcaatcagccctatgccgggccctccttg
ctcttttcttcagtcactatggataagattatgactaaacgccttgcagcttctgtaggt
gtccccgtagttccttatcagccattgactttacatgcctggaaaagaacgccagagtta
tgtatgcataagattgcagaggcctttactttccctatgtttgtgaaaaccgcacatttg
ggatcaagtatcggcgtttttgaagtgcataatgaagaagaactaaaagcaaaaatatcc
gaagccttcctctatgatacagatatttttattgaagaaagtcgtttaggatctcgtgaa
atagaagtgtcttgtctcggagactctagtagctgttactatatttctgaaccacatgaa
cgttgtggtgaaaaaagatttattagttatgaagataagtacggattaaatggtagaact
agcgcgcaaatacaatacgatttggatctctctgaagaattaaaaataagagtcaaggag
ttaacagaacgaatgtatcgtgttatccaagggcaaggttcatgtagagtggatttcttt
ttagatgatgaaggaaatttttggctttctgaaatgaaccctattccaggaatgacaaag
gcaagtccatttcttcatgattttgtccgtttaggatggactttcgaacaagtcattcat
caattgattatatcagggctacataagtttgatcagaagaaaaaggtcggcagaaccttg
aataagcagtgtctagtaactgcgaagagctaa

DBGET integrated database retrieval system