KEGG   Caldithrix abyssi: Cabys_2590Help
Entry
Cabys_2590        CDS       T04549                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
caby  Caldithrix abyssi
Pathway
caby00564  Glycerophospholipid metabolism
caby01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:caby00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Cabys_2590
Enzymes [BR:caby01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Cabys_2590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 HI0933_like NAD_binding_8 GIDA Pyr_redox_3 Thi4
Motif
Other DBs
NCBI-ProteinID: APF19339
UniProt: H1XNK6
LinkDB All DBs
Position
3093848..3095416
Genome map
AA seq 522 aa AA seqDB search
MNRDYFVQQLERSADSPWDVLIIGGGATGLGCAVDSATRGFKTLLVEQADFAKGTSSRST
KLVHGGVRYLAQGDVSLVFEALHERGLLMQNAPHLVKNQPFIIPLYEWWEGPFYNIGMKV
YDLMAGKLGFGPSEKLSKEETLNAIPNLDQHGLMGGVIYFDGQFDDARLAVNLAQTAVDH
GATVLNYFKVIELLKDASGLLEGVVIRDMESGQSFTVKAKTIINATGVFSDQIRQLDEPG
MPPSIVPSQGVHLMVDQSFLQGNSSIMIPHTDDGRVLFAVPWHNEVIIGTTDTPVSEITL
EPRAKDEEIEFLLTTSARYLKKDPLASDVLSVFAGLRPLAAPQGSAAKTKDISRRHQITI
SRSGLITVTGGKWTTYRKMAQETIDRAILVGGLQEKDCVTKQLPIHGYRLNTHFDEPLYY
YGDDRPQIESLINAQPTLRERLHPALPYLKAEVIWATRQEMARTVEDFLARRSRALFLNA
RASMEMAPIVAQLMAGELNQSNQWIETQIEQFKNLAKHYLLE
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
ttgaatcgtgattatttcgtccaacagcttgagcgctctgccgacagcccctgggatgtg
ctgattattggcggcggcgccacgggcctgggctgtgcggtggattctgccacgcgcgga
tttaaaaccctgctcgttgaacaggccgattttgccaaaggcacctccagccgcagcacc
aaactggtgcatggcggcgtacgctacctggcgcagggcgatgtgtcgctggtttttgaa
gccctgcacgaacgcggcctgctcatgcaaaacgcgccgcacctggtcaaaaatcagcct
tttatcatccctctgtacgaatggtgggaaggccctttttacaacatcggcatgaaggtt
tacgacctgatggccggcaaattaggctttggaccttctgaaaaattgagcaaagaagaa
acattaaacgccattcccaatctggatcagcacggtttaatgggcggggtgatctacttc
gacggccagtttgacgacgcccgcctggccgttaacctggcccaaaccgcggtggatcat
ggcgccacggtcttaaattatttcaaagttatcgaactgcttaaagacgcttccggcctt
ttagaaggcgttgtcatccgcgatatggaaagcgggcagagctttaccgttaaagccaaa
accatcattaacgccaccggcgttttttcggatcagattcgccagctggatgaaccggga
atgccgccttccattgtgcccagccagggcgttcatttgatggttgatcaaagttttctg
cagggaaattcttcgatcatgattccgcacaccgacgacggacgcgtcctgtttgccgtt
ccctggcacaacgaagtgatcattggcacaaccgacacgcctgtcagcgagattacatta
gagccgcgggcaaaagatgaagaaattgagtttttgctaaccacatccgcccgctattta
aaaaaagatcctttggcttccgacgttttaagcgtctttgccggcctgcggcccttagcc
gcgccacagggttccgctgcaaaaaccaaagatatttcccgtcggcaccaaatcaccatt
tcacgctccggattaatcaccgtcaccggcggcaagtggactacctaccgcaaaatggcg
caggaaaccatcgacagggccattctggtgggcggcctgcaagaaaaagattgcgtcacc
aaacagctgcccattcacggttaccgcttaaacacccattttgatgagccgctctactac
tacggcgacgatcggcctcaaatcgaatcgctgatcaatgcgcagcccacattacgtgaa
cggcttcaccctgcgctgccctatcttaaggccgaagtaatctgggccacacgccaggaa
atggcgcgcacggtggaagattttctggcgcgtcgctcgcgggcgcttttcttaaacgcc
cgggccagtatggaaatggctcccattgtggcgcagttgatggccggcgaattgaatcaa
tccaatcaatggatcgaaacacaaatcgaacaattcaaaaacctggcaaaacactattta
ctggaataa

DBGET integrated database retrieval system