KEGG   Caldithrix abyssi: Cabys_3041Help
Entry
Cabys_3041        CDS       T04549                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
caby  Caldithrix abyssi
Brite
KEGG Orthology (KO) [BR:caby00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:caby01001]
    Cabys_3041
Enzymes [BR:caby01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Cabys_3041
Protein kinases [BR:caby01001]
 Serine/threonine kinases: Other
  Bacterial family
   Cabys_3041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Pkinase_fungal DUF4366
Motif
Other DBs
NCBI-ProteinID: APF19789
UniProt: H1XNV3
LinkDB All DBs
Position
complement(3623200..3625260)
Genome map
AA seq 686 aa AA seqDB search
MERIGKYQKIKTLGSGGMATVYLVRDELTGMKMAMKLLYDHYAEDPHIRKRFLQEARLQL
DLNHPNIVRCYNVERVDNKYFILLEYIPGPALSEVIKQRGHGLKLEEIVPVFTQILAGMD
YAHQKGVIHRDIKPMNILLSEYSGYFHGYEVAKISDFGIAKALDQEGHTRTGAQLGSPYF
MSPEQIQNAAGVDHRSDIYSLGVLLYQLATGKLPYHPTDNPIKLMEEIVKEPIIDPRTFN
KDIPNWLVDVINKATDKDPEKRFQTCSQFSNLIFAHFTQAQQPTKNSRVTVQKKTPVVSE
RPKKKPTKSRSNIDNRQSNWLPLVLGVVVAVFLLAGVIFWQFNSRTSLDKYIGEPVEQVQ
QELINKGHEVITEYVYRENIPHDQVFNLEFTDHSKSAVRLWVSKGPKYLYLPDLIGADVF
AAINYLKKQGLKVNLKKVKNRSNAMGAVLKTVPPAKTLCKNGDEVTLVASYNAAAPLKDE
IKFSPNAIKYLKKNNLLISNTLLEQTFSGAESDYKTFTELNTDMMTVAIENDRLIINKKQ
SKGAMAYYFPVDLNGATSGIIARLDLARDFPASRNENLGLSVKYEDDFLYTSLLDMINHK
LSIALLQNKKTFKWKEYPMSFSQFKNKNILIVEVIALNDEIVLLINGEMQNKTKLPLNRA
LKQIGLLLPEKAGSILLDNLIIDGLI
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atggagagaatcggaaaataccagaaaatcaaaacacttggctctggcggtatggccacg
gtttacctggtgcgggatgagcttactggtatgaaaatggctatgaaactgctttacgac
cattacgcggaagatccacatatacgtaaacgttttttgcaagaagcgcgtctgcaactg
gacttaaaccatcccaatattgtgcgctgttacaatgtggaacgggttgataacaagtat
tttattcttctggaatatattcccgggccggctcttagcgaggtgattaagcagaggggc
catggcctgaagcttgaagaaattgttcctgtttttacacaaattcttgccggtatggat
tatgcccatcaaaagggagtgattcatcgcgatatcaagccaatgaatatccttctttcg
gaatattccggttattttcatggatatgaagtggccaaaataagtgattttggaattgcc
aaggcgctggatcaagaggggcatacgcgaacgggcgcccagttaggttcgccctatttt
atgagtccggaacaaatccagaacgcggccggcgttgatcatcgttccgatatttacagc
ctgggcgtgttgctctaccaattagccacaggaaaattgccgtaccatcccactgacaat
cctattaaattgatggaagaaatcgttaaagaacccatcattgatccgaggacttttaat
aaggatattcccaactggctggttgatgtcattaataaagcgaccgataaagatccggaa
aagagatttcagacctgttctcagttttcaaatttgatttttgcccattttacgcaggcg
cagcaaccaacgaaaaatagtcgtgtgactgtgcagaaaaaaactccggtcgtaagcgag
cgcccgaaaaagaagcccactaaatccagaagcaatatagataatcgtcaatctaactgg
ctgcccctggttctgggcgtggtagtggcggtctttttgctggcaggcgtcatattctgg
caatttaacagcagaacatcgctggataaatatattggcgagcctgtagaacaggtgcag
caggagctaataaataagggccatgaagtaataaccgaatatgtttacagagagaatatt
ccgcacgatcaggtatttaatctggaatttaccgaccattcgaaatccgctgtccgtttg
tgggtgagcaaagggcccaaatacttatatttgcctgatctgattggcgcggacgtgttt
gcggcaattaactacctgaaaaaacagggcctaaaagttaatttgaagaaagttaaaaac
cggtcgaatgcaatgggcgccgtgttaaaaaccgttcccccggcaaaaacgctctgtaaa
aatggggatgaagttaccctcgttgcgagttacaatgccgccgcccctttaaaagatgaa
ataaagttttcaccaaacgctatcaaatatttgaaaaaaaataatctattaatttctaat
acgttactggaacagaccttttccggcgcggaatctgactataaaactttcaccgaatta
aatacagatatgatgacggtagcaatcgaaaacgaccgcttaatcatcaataaaaagcaa
tcaaaaggtgcaatggcctattattttccggttgacttaaatggcgcaacctcgggaatt
attgcccgattagatcttgcccgggactttcccgcatctcgaaatgagaatctgggcctt
tccgtaaaatacgaagatgattttttgtacacctcacttttagatatgatcaatcataaa
ttatcgattgcccttttgcagaataagaagacctttaaatggaaagaatatcctatgtct
ttttctcaattcaaaaacaaaaatattttaatcgtcgaggtcattgcccttaatgatgaa
atagttcttttgataaatggcgaaatgcagaataaaacaaaacttccgttaaatcgggca
ttgaagcaaatcggattgcttttgcctgaaaaggccggaagtattttgctcgacaatctc
atcattgacggtttgatttaa

DBGET integrated database retrieval system