KEGG   Caldithrix abyssi: Cabys_3559Help
Entry
Cabys_3559        CDS       T04549                                 

Definition
(GenBank) maltodextrin phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
caby  Caldithrix abyssi
Pathway
caby00500  Starch and sucrose metabolism
caby01100  Metabolic pathways
caby01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:caby00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cabys_3559
Enzymes [BR:caby01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Cabys_3559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase Glyco_transf_5
Motif
Other DBs
NCBI-ProteinID: APF20305
UniProt: H1XTB8
LinkDB All DBs
Position
4269783..4272326
Genome map
AA seq 847 aa AA seqDB search
MTDRKSLPDKLQPLEGLSQNLWFSWNHKALQLFQSIDAELWESSGHNPVALLQDVSAERL
QQLSNDQDFVEKLNRIHQEFQNYLQSQPTVFQQQFPDLTDKIVAYFSAEFGVHESLPNYS
GGLGILAGDHLKSASDLGLPLVGVGLFYKYAYFNQQLDEHGNQIESYDALDPQRLALKLV
TDSTGQPIKISVFLKDHEVKAQIWQADVGRVKLYLLDSNVPENAPADQEITSTLYGGDRE
MRIRQEILLGIGGIRALRAMGYEPTVIHMNEGHSAFSGLERLRELMEKGLTFEEAYQMVR
NSALFTTHTPIPAGNEAFEFDLMRAYFKPFWENLGLGEQQFFDLGRNVNEHKHENFSLTV
LALNLSSMANGVSAIHGNVSRAMWKHIFPGIPESEIPIGHITNGIHTETWLHPLMIQMFE
EYLGKDWRENIRNAEYWKKIDDVPDSVFWQTMQEMRQEMADYLRAEYQKRLERFANAEHH
FPAPDAILDPNILTIGFARRFAPYKRATLIFRDPERLKKILNDPQRPVQIIFAGKAHPHN
DAGKELIRTINRFAQEEGYRGKIVFVEGYSMAISRAMVSGSDVWLNNPRRPLEASGTSGQ
KVPINGGINLSIMDGWWPEAFNGKNGWAIGDDIEFADPERQDQHDSQSLYELLEKEVVPN
FYDRDENGVPLRWVKMAKESLKTIIHQFSTHRMVWEYIEKYYVPGMKQATKLSSNQFSLL
KEHVRWLKNISAKWPTIHFSVLSNGAENRIFSAGEERDIHVVVHLDGLKPEEVTVELVLE
RQDALQRSQNMETVALPLEKNLGQGQYQYGKKVRAKTDGAYRFSCRVLPRNENLLHKHDT
RLIKWLD
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atgacggatcgaaaatcattgccagataaattacaaccactggaaggtttgagccaaaat
ctatggtttagctggaatcacaaagcgcttcaattattccagtccatagatgctgaatta
tgggaaagtagcgggcacaatccggtcgctcttttacaggatgtttctgcggaacgctta
caacaactgagcaatgatcaggactttgtggaaaaactaaatcgtattcatcaggagttt
cagaattatttgcagagccagcctacggttttccaacaacagtttccggatttaaccgac
aaaatcgttgcctatttttccgccgaatttggcgttcatgaatcgctgcccaattactcg
ggcgggctgggcattctggcaggcgaccatctgaaatcggccagcgaccttggcctgcct
ctggttggcgtgggattgttttacaaatacgcctattttaatcagcagcttgatgagcac
ggcaaccaaatcgaatcctacgacgcgctggatccgcaacgtctggccctaaaactggtg
accgattctaccggtcaaccgattaaaatttctgtctttttaaaagaccacgaagtcaaa
gcacaaatctggcaggccgacgtggggcgcgtaaagctctatttactggacagcaacgtt
ccggagaacgccccggcggaccaggagatcaccagcacgctttacggcggcgatcgcgag
atgcgcattcggcaggagattcttttggggatcggcggcattcgtgcgctgcgtgccatg
ggctacgagcctaccgtcattcacatgaatgaaggccattccgctttttccggtctggaa
cgtttgcgggagttgatggaaaagggtctaacctttgaagaagcgtatcagatggtgcgc
aattccgcactgtttaccacgcatacgcccattcccgcgggcaacgaggcttttgaattc
gaccttatgcgcgcctattttaaacctttctgggaaaacctgggccttggcgaacaacaa
ttttttgatctgggacgtaatgttaacgaacacaaacatgaaaacttttctttaaccgtg
ctggccttgaatctttccagcatggccaatggcgttagcgccattcacggcaatgtttcc
cgcgccatgtggaaacacatcttcccgggcataccggaaagtgaaattcccatcgggcac
atcaccaacgggattcacaccgaaacatggctgcatcccctgatgattcagatgttcgaa
gaatatctgggcaaggactggcgtgaaaatatccgcaacgccgagtactggaagaagatc
gacgatgttcctgattctgtgttctggcaaaccatgcaagagatgcgccaagaaatggcc
gactatttgcgcgccgaatatcaaaaacggctggaacgatttgcaaacgccgaacatcac
ttccccgctcccgatgccattctggatccgaacattctgaccatcggctttgcacgcaga
tttgccccctacaagcgggccactttaatcttcagagacccggaaagattaaagaaaatt
ttaaacgatccacaacgaccggtgcaaattattttcgccggcaaggcccatccgcacaac
gatgcaggtaaagaattgattcgcaccatcaatcgttttgcacaggaagagggctaccgt
gggaagatcgtgtttgtggaaggttattcgatggccatctcccgcgccatggtttccgga
agcgatgtttggttgaacaatccgcgccgcccgctggaagccagcggaacgtccggccag
aaagtgccgataaacggcggaatcaatttgtccattatggacggctggtggccggaagct
tttaacggtaaaaacggctgggccattggcgacgatattgagtttgccgaccccgaaaga
caggatcagcatgacagccagtcgctgtacgaattgctggaaaaagaagtcgtgcccaat
ttttatgatcgcgatgaaaacggcgtgcccttacgctgggtcaaaatggccaaagaatcg
cttaaaaccatcatccaccagtttagtacgcaccgcatggtgtgggaatacatcgaaaaa
tactacgttccgggtatgaaacaggcaacaaaattatcgagcaaccagtttagcttactg
aaagaacatgtgcgctggttaaaaaatattagcgccaaatggccaacaattcactttagc
gtgctgagcaacggcgccgaaaacaggatctttagcgccggcgaagagcgcgacattcat
gtggtcgttcacctggatggcttgaaaccggaagaggttacggtggaactggtgctggaa
cggcaggacgccttacaacgctcccagaatatggagacggttgcattgcctctggaaaaa
aatctggggcagggacaatatcaatacggcaaaaaagtgcgcgcaaaaacagatggcgcc
taccgcttttcctgccgcgttctgccgcgtaatgagaacttgctgcataaacacgacacg
cgtttgattaagtggctggattaa

DBGET integrated database retrieval system