KEGG   Clostridium acetobutylicum ATCC 824: CA_C0492Help
Entry
CA_C0492          CDS       T00056                                 

Gene name
alr
Definition
(RefSeq) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
cac00473  D-Alanine metabolism
cac01100  Metabolic pathways
cac01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cac00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CA_C0492 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CA_C0492 (alr)
Enzymes [BR:cac01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CA_C0492 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:cac01011]
 Precursor biosynthesis
  Racemase
   CA_C0492 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-GeneID: 1116675
NCBI-ProteinID: NP_347132
UniProt: Q97LR2
LinkDB All DBs
Position
565849..567009
Genome map
AA seq 386 aa AA seqDB search
MFRHIRPVWAEIDLDNIAYNMQQIRRCSKSDEIIGVVKADAYGHGAVDVAPVLLENGANR
LAVAVISEAVELRKSGIQCPIMILGYTPLSLVDSIIKYSIEQTVFSYDYAEKLSEAARQK
NITLRIHIALDTGMGRIGFLPTEESVWEVYKISKLSNIIIEGIFSHFSTSDETNKEYTYA
QLKKFEWFYNELRKKNIKINIRHIGNSAAIMELPETHFEATRPGIILYGYYPSNEVDKNK
LNLKPIMTLKTNVVHIKKMMPGEYVSYGRKFKCERESIIATLPVGYADGYTRMLSGKAKV
IINGNYAPVIGRICMDQCMIDITDLPSVQVGDEVVIMGESDDKKFTADDMAEIIGTINYE
VICMISKRVPRVYIKNGEVVKIRNYV
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgttcagacatataagacctgtatgggctgagatagatttagataatattgcatataat
atgcagcaaattagaaggtgttcaaaaagtgatgaaataataggggtagttaaggctgat
gcatatggtcatggagctgttgatgtagcaccagtacttttggagaatggtgcaaatcgt
cttgcggttgctgtgataagcgaagctgtagaactgagaaagtcaggaattcaatgtccg
ataatgattttaggttatacacccttaagtttggtggatagtattataaaatacagtata
gaacaaactgttttttcatatgattatgcagaaaagctatctgaggcagcaaggcaaaag
aatataacgcttagaatccatatagcattagatacagggatggggagaataggatttttg
ccaacagaggaaagtgtatgggaagtttataaaataagtaaactttcaaacataataata
gaaggaatattttcacacttttcaacatctgatgagacaaataaagaatatacgtatgca
caattaaagaagtttgaatggttttataatgaattaagaaagaaaaatattaaaataaat
ataagacatataggcaacagtgctgccataatggaattgccagaaactcattttgaggct
acaagacctggcattatactatatggatactatccatcaaatgaggttgacaagaataag
ttaaacttaaaacccattatgacacttaaaaccaatgtggttcatataaaaaaaatgatg
cctggtgaatatgttagctatggcagaaagtttaaatgtgaaagagagagtattatagct
acacttcctgttggatatgcagatggatataccaggatgctttcaggcaaggcaaaagta
ataattaatggtaactatgcgcctgttatcgggaggatttgtatggatcaatgtatgata
gatattactgatcttccaagcgttcaagttggagacgaagttgtaattatgggtgaaagt
gatgataaaaaatttacagcagacgatatggctgaaatcataggaacaataaattacgaa
gttatttgtatgataagcaagcgtgtaccacgcgtttatataaagaatggggaagttgta
aaaataaggaattacgtgtag

DBGET integrated database retrieval system