KEGG   Clostridium acetobutylicum ATCC 824: CA_C0743Help
Entry
CA_C0743          CDS       T00056                                 

Definition
(RefSeq) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
cac00010  Glycolysis / Gluconeogenesis
cac00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:cac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CA_C0743
   00500 Starch and sucrose metabolism
    CA_C0743
Enzymes [BR:cac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     CA_C0743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase DUF3226
Motif
Other DBs
NCBI-GeneID: 1116926
NCBI-ProteinID: NP_347379
UniProt: Q97L23
LinkDB All DBs
Position
862627..864042
Genome map
AA seq 471 aa AA seqDB search
MGVKFPEGFLWGGATAANQFEGAYNQDGKGLSIQDIMPKGIRGPITDKPTEDNMKLIGID
FYNRYKEDIKLFAEMGFKTFRLSIAWSRIFPNGDDKQPNEKGLQFYDNVFDELAKYNIEP
LVTISHYETPLALAKNYDGWTNRKLIGFFENYVRTIFNRYKNKVKYWLTFNEINSALHAP
YMSAGIWTPKEKLSKQDLYQAMHHELLASALAVKIGHEINPEFKIGCMILGVPNYPLTSK
PSDVLKAMNQDRENLFFADVHARGRYPKYMNRLFKENNVHIKMEPGDEEILKNTVDFISF
SYYMSSCATSDTKKSKGGAGNIISGVPNPYLKASEWGWQIDPEGLRYILNLLYDRYQKPL
FIVENGLGAVDELITDERGNKTVNDDYRINYLNDHLVQVGEAIEDGVELMGYTTWGCIDL
VSASTAELKKRYGFIYVDRHDDGSGTLERYKKKSFYWYKEVIATNGASLKK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgggagttaaatttccggaaggatttttatggggaggagctacggctgctaaccaattt
gaaggagcttataatcaagatggtaagggcttatctattcaagatataatgccaaaaggt
ataagaggacctataactgataagccaacagaagataatatgaaacttataggtattgat
ttttataacagatataaagaagacataaagttgtttgcagagatgggctttaaaaccttt
agattatcaattgcgtggtctagaatattcccaaatggtgatgataagcagccaaatgaa
aagggacttcaattttatgacaatgtatttgatgaattagctaagtataatattgagcct
ttagttacaatatctcattatgaaacaccattagcacttgctaaaaattatgatggttgg
actaatagaaaactcataggcttttttgaaaattatgttaggacaatatttaatagatat
aaaaataaggtaaaatattggctcacttttaatgaaataaattcagctctccacgctcct
tatatgagtgctggaatatggacaccaaaggaaaagttgagcaaacaagatttatatcaa
gctatgcatcatgaattacttgccagtgctcttgcagttaagataggtcatgaaataaat
ccggaatttaaaataggatgtatgattcttggagtaccaaactatcctcttacttcaaag
ccaagcgatgttcttaaagcaatgaatcaggatagagaaaatcttttctttgcagatgtt
catgcaagaggaaggtatccaaaatatatgaatagattatttaaggaaaataatgtacat
ataaagatggagccaggggatgaagaaatattaaaaaatacagtagactttatttctttt
agctattacatgagttcatgtgcaacatccgacactaaaaagagtaagggaggggcagga
aatattatttctggagtgccaaatccttatttgaaggcttcagaatggggatggcaaata
gatccagaaggattaaggtatatactcaatttgttatatgatagatatcaaaagccttta
tttatagttgaaaatggtttaggtgctgtggatgaattaataacagatgaaagaggtaac
aaaaccgtaaatgatgattatagaatcaactatctaaatgatcatttggttcaagtagga
gaggccatagaagatggtgttgagctaatgggttacactacttggggatgtatagattta
gtaagtgcatcaactgctgaacttaagaaaagatatggttttatatatgtagataggcat
gatgatggaagtggtacattagaaagatataagaagaaaagtttttattggtataaggaa
gttatagctacaaatggagctagtttaaagaaataa

DBGET integrated database retrieval system