KEGG   Clostridium acetobutylicum ATCC 824: CA_C2887Help
Entry
CA_C2887          CDS       T00056                                 

Gene name
tdk
Definition
(RefSeq) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
cac  Clostridium acetobutylicum ATCC 824
Pathway
cac00240  Pyrimidine metabolism
cac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cac00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CA_C2887 (tdk)
Enzymes [BR:cac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CA_C2887 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_14 Zn_ribbon_SprT
Motif
Other DBs
NCBI-GeneID: 1119070
NCBI-ProteinID: NP_349490
UniProt: Q97F65
LinkDB All DBs
Structure
PDB: 

Position
complement(3018447..3019034)
Genome map
AA seq 195 aa AA seqDB search
MYRPKDHGWVEVIVGPMYSGKSEELIRRIRRAKIAKQKIQVFKPEIDNRYSKEDVVSHMG
EKEQAVAIKNSREILKYFEEDTEVIAIDEVQFFDDEIVEIVNKIAESGRRVICAGLDMDF
RGKPFGPIPELMAIAEFVDKIQAICVVCGNPATRTQRLINGKPAFYDDPVVLIGAMESYE
ARCRKCHVVPQKKEV
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtacagaccaaaggaccacggatgggttgaggttattgtaggaccaatgtatagtggg
aaatcagaagaacttataagaagaataagaagagctaaaattgcaaaacaaaaaattcaa
gtttttaaacctgaaatagataacagatatagtaaagaagatgtagtttctcatatggga
gagaaggaacaggcagttgcaattaaaaatagtagagaaatattaaaatattttgaggag
gatacagaggtaattgcaatcgatgaggtacagttttttgacgatgaaatagtagaaatt
gtaaataaaattgcggagagtggtagaagagtaatttgcgctggacttgatatggatttt
agaggtaagccatttggacctataccagagcttatggctattgcagaatttgtagacaag
attcaggcaatatgcgttgtatgtggaaatccagcaactagaacgcagaggttaataaat
ggaaagccagcgttttatgatgatccggtggttttgataggagcaatggagtcttatgaa
gcaagatgtaggaaatgccatgttgttccacaaaaaaaagaggtgtaa

DBGET integrated database retrieval system