KEGG   Clostridium aceticum: CACET_c20840Help
Entry
CACET_c20840      CDS       T03971                                 

Gene name
prkC
Definition
(GenBank) serine/threonine-protein kinase PrkC
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cace  Clostridium aceticum
Brite
KEGG Orthology (KO) [BR:cace00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cace01001]
    CACET_c20840 (prkC)
Enzymes [BR:cace01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CACET_c20840 (prkC)
Protein kinases [BR:cace01001]
 Serine/threonine kinases: Other
  Bacterial family
   CACET_c20840 (prkC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like DUF3244 GET2 Kdo RIO1 YrbL-PhoP_reg ETRAMP
Motif
Other DBs
NCBI-ProteinID: AKL95531
UniProt: A0A0D8I6Z8
LinkDB All DBs
Position
complement(2160031..2161992)
Genome map
AA seq 653 aa AA seqDB search
MIGKILGGRYEIVEKVGGGGMALVYKAKCNLLNRYVAVKILRSEFTSDKDIIEKFKRESQ
AAASLSHPNIVNLYDVGEEDDIYYIVMEYVKGKTLKEVIKEKGILTLHEIINYTKQIASA
LQHAHYNHVVHRDIKPHNILVTEDNRAKVTDFGIAIAATSSTITNMGSVIGSVHYFSPEQ
ARGGYTDEKSDLYSLGIVMYEMATGKVPFEGESPIAVALKHIQQEPVPPSEIIPEISKSL
EEIILKLMQKDQASRYQNTQSLIENLGKLKEDVVSSEMTMMINHEDSPTQIIPRIKEEDI
ETPKAPLPKNKKGNNKLMIAAAVAAALIAALLFMFGLFYVSNLNFFRTEDVQVPSLVGKD
ILEAREMASQLGLELSERSINSTEVPKNEIINQETDAGMKVKKGYPIRVVVSAGPDMAQV
PDLRFKEAANAPLMLRNEGLSEGRVTENFSEFPIGVVIEQNPRAGSSVPAGSTVDYVISK
GPQVVTFPMPNVVGNTRESAEATLRQLQLQIGAITEAPSNEHAEGRVIFQSIPPETPIAQ
NAVVNLTISTGPEVIDEPEDVTPPEDETPETPEEDQSASATLSTQNVRIQLPGHSGIVEI
AIKRVSDGEEVYKRKHDLDKDGHTVVVPLTGYAKQEFELFVNAQKHKNNIVLR
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgattggcaaaatactaggtggtcgatatgaaattgttgaaaaagtcggaggcggcggt
atggctttagtttataaggccaagtgcaacttattaaatagatacgtagcggtaaaaata
ttaagatcagaatttactagtgataaagacattatagaaaagttcaagagggaatctcaa
gccgctgcaagcttgtcccatccgaatattgtaaatctgtatgatgttggagaagaagat
gatatttactatattgttatggagtatgtcaagggaaaaactttaaaggaagtaataaag
gaaaagggcatattaactttgcatgaaattattaattatacaaagcaaatagcttcagcc
ttgcaacatgcccattataaccatgtagttcatagagatattaaaccccataatattcta
gtcacagaagataatagagcaaaggtaacagattttgggattgctattgctgccacttct
tctaccattaccaatatgggtagtgttataggctctgttcactatttttcaccagagcag
gccagaggtgggtatacagatgaaaaatccgacttatactcattggggattgttatgtac
gaaatggctacaggaaaagtaccttttgaaggggaaagtcctatagcagtagcattaaag
catattcagcaggagccggttcctccctcggagattattccagaaatttctaagtcttta
gaggaaattatactaaaactgatgcagaaggatcaagcctccaggtatcaaaatacacaa
agtttaatagaaaatttaggtaaattaaaggaagatgttgttagtagtgagatgacgatg
atgatcaatcatgaagactcacctacgcagatcatacctcgtattaaggaagaagatatt
gagacacctaaggcaccattgcctaaaaataaaaaaggtaataataagctaatgattgct
gctgcagttgcggctgctttaattgcagcattgttatttatgtttggacttttttatgtg
agtaacttaaactttttcagaacagaagatgtgcaggttccaagtttagtaggcaaggat
attctcgaagctagagaaatggctagccaattaggcttagaattaagtgaaaggtctata
aatagtacggaagtaccaaaaaatgaaattattaatcaggaaactgatgctggtatgaag
gtaaagaagggctatcccatcagagtagtggtaagtgcaggtccagatatggcacaggtg
ccggacttgcgatttaaagaggcagcaaacgcccccttgatgctaagaaatgaggggttg
agtgaagggcgtgttacagaaaattttagcgaatttcctattggtgttgtaatagagcaa
aatcctagagcagggtcttcagtaccggcaggatctacggtggattatgttatcagcaaa
gggcctcaagtagttacttttccaatgcctaatgtagtaggcaatactagggaaagtgct
gaagccacattaagacagttgcaattacaaataggtgctattacagaagcacctagcaac
gaacatgcagaaggtcgtgtgatcttccaaagtattcctccagaaacgccgatagcacaa
aatgcagtggttaatttaacgataagtacaggaccagaagtaatcgatgagccggaggat
gtaacaccaccagaagatgaaacaccagaaacaccagaggaggaccaaagcgcgtcagca
actttatctactcaaaatgtaaggatacaattaccaggtcatagcgggattgtggaaatt
gccatcaagagggtatctgatggagaagaggtatataaaagaaagcacgacttggataaa
gacgggcatacggtagtagtccctctcactggttatgcaaaacaagaatttgaactgttt
gtaaatgcccaaaaacataagaataatattgtactaagataa

DBGET integrated database retrieval system