KEGG   Clostridium aceticum: CACET_c29650Help
Entry
CACET_c29650      CDS       T03971                                 

Gene name
aor2
Definition
(GenBank) tungsten-containing aldehyde ferredoxin oxidoreductase Aor
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
cace  Clostridium aceticum
Pathway
cace00030  Pentose phosphate pathway
cace01100  Metabolic pathways
cace01120  Microbial metabolism in diverse environments
cace01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cace00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CACET_c29650 (aor2)
Enzymes [BR:cace01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     CACET_c29650 (aor2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AKL96409
UniProt: A0A0D8ICR0
LinkDB All DBs
Position
3143785..3145578
Genome map
AA seq 597 aa AA seqDB search
MNGYAGKILRVDLSNKTVTTENLDHKTAEKFIGGRGLATKILMDEVDPNVDPLSPKNKLI
FMTGPLTGTNTPTGGRYMVVTKSPLTGAVANSNSGGYWGAEMKFAGYDGIIIEGKAESPV
YINIVDDKVEIKDAVHLWGKVVSETTEVLQKEHGEKVKVATIGPAGENLSLMAAIMNDRD
RAAGRSGVGAVMGSKNLKAITVKGNGTVGVRDKNKLKEVFSRCIKKIKENGLTGQGLPTY
GTAILVNVINENGVFPTNNFQLSTFDKSEEISGETLTEKYLTKKEACFRCPIACGRYCEV
DDIKGGGPEYETIWAFGADCGVSSMPDIIKANYWCNEMGLDTISAGATLAAAMELYQKGY
IKKEEFAGGPELQFGNAEAVVEWTKRTGLSLGLGAKLAQGSYRLCESYGVPEISMTVKKM
ELPAYDPRGIQGHGLQYATCNRGGCHVRGYMIAPEIAGLPEKLDRFSLEGKPVWVKTFQD
MFAAIDSLGLCVFTSFALDADDFADLYSAVCGTNLTGSDFLAAGDRVWTFEKLYNLKAGI
DSSQDTLPQRLLKEPIPDGPSKGWIHKLDELLPEYYKVRGWDVNGVPTVEKLKELGL
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgaatggctacgcaggtaaaattttaagagtagatttaagtaataaaacagtaactaca
gaaaatttggatcacaaaactgcagaaaaatttattggagggaggggcctagcaacaaaa
atactaatggatgaagttgatcctaatgtcgatcctttaagtcctaaaaataagcttatt
tttatgacaggtccactgacaggcacaaacacacctacaggtggtagatacatggttgta
acaaagtcacccctaacaggagcagttgctaattcaaattctggtggttattggggtgca
gaaatgaaatttgccggctacgatgggatcatcatcgagggcaaggctgaatctccagta
tatatcaacattgtagacgacaaggtagaaattaaagatgctgttcatctttggggaaaa
gtcgtttctgaaactactgaagttcttcaaaaagaacatggagaaaaagtcaaagtagcc
actattggacctgctggcgaaaatctttctctcatggctgctatcatgaatgatcgtgat
agagctgcagggcgttctggtgttggtgctgtaatgggttcgaaaaacctcaaagctatc
acagttaaaggcaacggcacagtaggcgttagagataaaaataaacttaaagaagtattc
tctaggtgtataaagaaaattaaagaaaacggactcaccggtcaagggcttccaacctac
ggtactgcaatactggtgaatgtaatcaatgagaatggtgtgtttcctacaaataatttt
caattgtcaaccttcgataaatctgaagaaataagtggtgagaccctaacagaaaaatat
ttaactaaaaaagaagcttgcttcagatgtcccattgcttgtggaagatactgtgaggta
gacgacatcaagggcggtggacctgagtatgaaacaatttgggctttcggtgctgactgc
ggtgtctccagcatgccagatataattaaagctaattattggtgcaacgaaatgggatta
gatacaatctctgctggggcaacattagctgcagccatggaattatatcaaaaaggatac
atcaagaaagaagagtttgctggaggtcctgaacttcagtttggaaatgctgaagccgtt
gtagaatggacaaagaggacggggcttagtcttggattaggtgcaaagctggctcaaggc
tcttatcgattgtgtgaaagttatggtgtacctgaaatttcaatgactgtaaagaaaatg
gaactaccagcttacgacccaagagggatccaaggacatggattacaatatgctacttgc
aaccgtggtggctgtcatgttagaggctatatgattgcccctgagattgcaggactgcct
gaaaaacttgaccgattctcactagagggaaagcctgtctgggtaaagacattccaagac
atgtttgcagccattgattcactgggattatgtgttttcacttcatttgcattagatgct
gacgactttgcagatttatacagtgcagtctgtggaacaaacttaactggctctgatttt
ttagccgctggcgatagagtttggacatttgaaaaactttataatttaaaagctggcata
gattcttctcaggataccctgccccaaagattactgaaagagcctattccggatggacct
tcaaaaggatggatacataaattagatgaactgcttcctgaatactataaagttagggga
tgggatgtaaatggtgtgcctacagtagaaaaacttaaagagcttgggttataa

DBGET integrated database retrieval system