KEGG   Clostridium aceticum: CACET_c33200Help
Entry
CACET_c33200      CDS       T03971                                 

Gene name
alr
Definition
(GenBank) alanine racemase Alr
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cace  Clostridium aceticum
Pathway
cace00473  D-Alanine metabolism
cace01100  Metabolic pathways
cace01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cace00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CACET_c33200 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CACET_c33200 (alr)
Enzymes [BR:cace01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CACET_c33200 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:cace01011]
 Precursor biosynthesis
  Racemase
   CACET_c33200 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Botulinum_HA-17
Motif
Other DBs
NCBI-ProteinID: AKL96764
UniProt: A0A0D8IBQ3
LinkDB All DBs
Position
complement(3510548..3511720)
Genome map
AA seq 390 aa AA seqDB search
MLTKDKLRPVWAEVNLDNLKHNIQEVSRVVKQDTLVCAVIKADGYGHGATVIAKTLLENG
ADRLAVATLSEAIELRRAGYQVPLMVLGYTKETQGEDLLEYNIIQTIYSYEQAAAFSQLA
LKKGKELVLHLKIDTGMGRLGFQVEEESVKEIKKIFQLPNIKIEGIFTHFAVADEKDKTF
TYHQFQRFMYLVDRLEKERCSIPIKHVSNSAAIIDLPEMNLDMVRAGIMLYGLYPSSEVN
KEAVHLRQVMELKSKVAHVKHLPSDRGVSYGLTYKTKGERKIITLPIGYADGFTRMLSHK
AEITVKGKKLPIVGRICMDQCMADATGVDINRDDEVCLFSSDQSSGNTIDDVAQKLGTIN
YEIVCMVGKRVPRLYMENNNTVYIRDHLLL
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgttaacaaaagataaattaaggcctgtgtgggcggaagttaatttagataacttaaag
cataatattcaagaagttagccgtgtggttaaacaagatacgttagtatgtgctgttatc
aaggcggacggttatggacatggggcaactgtgattgcaaaaactcttttagaaaacggt
gctgatcgactggcagtggctaccttatcagaggctatagaattaagaagagcaggttac
caggtccccttgatggtattgggatatacaaaagaaactcagggagaagatttattggaa
tataatattattcaaacgatttactcgtatgagcaggcagctgctttctcacagctggca
cttaaaaagggtaaagaattggtattacacttaaagattgatacagggatgggaaggtta
gggtttcaagtagaagaagaatccgtaaaggaaattaaaaagatttttcaactgcctaac
ataaaaatagaaggtattttcactcattttgctgtcgcagatgagaaggataaaactttt
acttatcatcagtttcagagatttatgtatttggtggatcggttagaaaaggaaaggtgt
tctattcctattaaacatgtgtctaatagtgccgctatcatcgatttgccagaaatgaat
ctagatatggtcagggctggtatcatgctatatggcttatatccttcatcagaagtaaat
aaagaagctgttcatctaagacaagtcatggaattaaagagcaaagttgcccacgtaaaa
catctgccctctgatcgaggagtaagttatggattaacctataaaacaaaaggagaaaga
aaaatcattactttgccaataggttatgccgatggttttacaagaatgttaagtcataag
gcagaaattacagtaaagggaaaaaaactcccgattgtaggcagaatttgcatggaccaa
tgtatggcggatgctacaggtgtagatataaatagagatgatgaggtatgtttatttagc
agtgatcaaagcagtggcaatacaatcgatgatgtggctcaaaaactgggaaccattaat
tatgagattgtatgtatggtaggaaagagagtaccgagactgtatatggaaaataataac
actgtctatataagagaccatttgttattatag

DBGET integrated database retrieval system