KEGG   Cutibacterium acnes KCOM 1861 (= ChDC B594): RN83_00315
Entry
RN83_00315        CDS       T04624                                 

Definition
(GenBank) hypothetical protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
cacn  Cutibacterium acnes KCOM 1861 (= ChDC B594)
Pathway
cacn00620  Pyruvate metabolism
cacn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cacn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RN83_00315
Enzymes [BR:cacn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     RN83_00315
SSDB
Other DBs
NCBI-ProteinID: ALD70613
LinkDB
Position
77097..80477
AA seq 1126 aa
MVTQAHMDSVNLRLALNGLPLPTAARASYIDVVAPVLARQRELRRELPELLCPADRRIQA
FIDRYLGEDSSVHPRLPDTTLTLDEPGLARALSLPVDGDDFSSDLVSSYRVANGVLHNPR
NDRRTTAGVFHVAEGGLAIPDDKKAVPIDVFARLLDLAFQAPPEHTLLPYTSTQPVDRQA
HTWVSLLLRPLVVPEVPGFVSERRMEIRFFAPGGLVSNLDFVEGIFGNSGDPLLPVNDSA
LAPSGWTGHSGCIILAPHLNLIRKVDLGLPHVDQATDRQRRDGMCWSDESELYNEGKPFK
LCARDESGVILTIVADNYFGYCKKEVKTQISYSANLFGLAEEEHSGGARAYISHNEGQEY
ATPVCDQTVSDVVMANPDHFEMLSDGQARVLDIDDVVMVPGGAKFSLRDGTVSWDNGDHS
IRMRADTEYISPAGYRIHMVHNDADDQWYLEGTYGDSTTLHKCCTVSGGGKSEISKAISD
TFLWGNAYSPDFEADMDAVDDILHRDYSTRFADPKLNGIDHRPVLSTERSVGSVIKLLTP
SSDFTDWYNDWINSIPAFRKELVFTIKRYYKPEWGDDWRSHFSVAPTNGRHGNMVRLDGQ
KVLVSMARVGFQPDGSWRLFTLRHDYAPAVKVQTEDDMTASIVTSPGVVTGPEGLSHKVV
ANCEALLFQRPDDAICRGYDTQTERDMSGRDLFISNYQPLTREDVRAMRDDVVAFSKFTP
PMRTFLSNFADSDPSEQPKFVVSSADPRLIDGVRSRNPRYLQVRPDIAKPRETAIANLAS
HLYHGLPIDEPLPLPVDVVAAGRRNNPPEGKIPALCAYNPLHYMELPELFMEFISSMTGK
SPSTTGAGSEGALTKAPFNALPAVFDLNSSFLSFVLSGYDGWLSSAGFIGPKVEVAHDIS
LLVPEIFCRMSPAERDAKTLIEGGYLEKLEDYDKDGELILASRLGYRMTEKFMRTYFGRI
FLHPDTVFTPEMLRPELQDADIFADSVRTISTTHARVAKAYFDDGTVSLAVPPIRALLEI
MVNGVCSEGWTLDDPELREMFTRESVLASDWYAERIDAKQAEAVRRAERGIAHLEQFMAD
PRNASACEEIDVQARLDQVRKFHDRAVTAEYRQQLVGTLGRQVNFR
NT seq 3381 nt   +upstreamnt  +downstreamnt
atggtcactcaagctcacatggattccgtgaatctaagactggcgctcaacggtctgcca
ctgccgacggctgcgcgcgcttcctacattgacgttgtcgccccagtcttggcccggcag
cgcgagctgaggagggaactccccgagctcctctgcccggccgaccgccgtattcaggca
ttcatcgaccgctacctgggcgaggactcttccgtccacccccgactgcctgacaccacc
ttgaccctcgacgagcccggcctcgcacgggccctctcgctacccgtcgacggcgacgat
ttcagttccgaccttgtctcgagctaccgagtggccaacggcgtcctacacaatccccgc
aatgaccgtcgcaccactgctggtgtattccacgtcgccgagggcggactggcaatcccc
gacgacaagaaggccgtgccgatcgacgtcttcgctcgtctgctcgacctcgccttccag
gccccgcccgagcacaccctgctgccttacacttctacccaaccggtcgaccgccaggcc
cacacctgggtttccttgttgctgaggcccctggtggtgcccgaagtgcccggtttcgtc
tccgagcgccgcatggagattcggttcttcgcccccggcgggctggtctccaacctggac
ttcgtggaggggatctttggcaacagtggcgatcccctcctgcccgtgaacgactcggcc
ctcgccccgtcaggttggactggccacagcggctgcatcatcctcgccccgcatctcaac
ctcatccgcaaggtagacctcggtctgccccatgtcgaccaggcaaccgaccgtcagcgt
cgcgacgggatgtgctggtctgacgagtctgagctctacaacgagggcaagccgttcaag
ctgtgtgcccgtgacgagtccggggtcatcctcactatcgtcgccgacaactacttcggc
tattgcaagaaggaggttaagacccagatctcctactcagctaacttgttcgggctggcc
gaggaggagcattccggcggcgcccgcgcctacatctcccacaacgagggccaggaatac
gccaccccagtctgcgaccagacggtttccgacgtcgtcatggccaatccggaccacttc
gagatgcttagcgacggccaggcccgggtactcgatatcgacgacgtcgtcatggtgcca
ggtggggccaagttcagtctgcgtgacggcactgtcagctgggataacggtgaccactcg
atccgaatgcgcgctgacaccgagtacatctcccccgccggttaccggattcacatggtc
cacaacgatgccgacgaccagtggtacctcgagggcacctacggcgattcgacgaccctg
cataagtgctgcacggtatccggtggtggaaagtcggagatctccaaggccatatcggac
accttcctgtggggcaatgcctactctccggatttcgaagccgacatggatgccgtcgat
gacatcttgcatcgggactactcgacgcggttcgccgatcccaagcttaacggcatcgac
catcgtccggtcctctcgacggagcgttcggtgggttcggtcatcaagctcctcacccca
tcctcggacttcaccgactggtacaacgattggatcaactcgattccggccttccgcaag
gagctggtcttcaccatcaagcgctactacaagccggaatggggtgatgactggcgctcc
cacttcagcgtcgcccccacgaatggtcgccacggcaacatggtccgtctcgacggccag
aaggtgctggtgagtatggcgcgcgtgggattccagcccgacggttcgtggcggctgttc
accctgcgccacgactacgctccggccgtcaaggtgcaaaccgaggacgacatgacggcg
tcaatcgtcacatctccgggcgtagtcaccggccctgaaggcctgtcgcacaaagtcgtc
gccaactgcgaagcgttgctcttccagcgccctgacgacgccatttgccgtgggtacgac
acccagaccgaacgtgatatgagcgggagggacttgttcatctcgaactaccagccgcta
acccgcgaggacgtcagggcaatgcgtgacgacgtggtggccttctcgaagttcacccca
ccgatgcgcaccttcctgtcgaacttcgccgattccgatccttctgaacagccaaaattc
gtcgtctccagcgccgatcctcgtcttatcgacggggtgcgttcgcgcaacccgcgctac
ttgcaggtgcgtccagacatcgccaagccgcgcgaaaccgcaatcgccaatcttgccagc
cacctgtatcacgggctgccgatcgacgaaccgctgcctctgccggtcgacgtggtcgcc
gctgggcgtcgcaacaatccacccgagggcaaaatcccggccttgtgcgcgtacaacccg
ctgcactacatggagctgccggaattattcatggagttcatctcctcgatgactggtaag
agtccttcgacgacgggagccggttcggagggagccctgacgaaggcaccgttcaacgcc
ttgccagcggtcttcgacctcaactcgtccttcctgtccttcgtgctatcggggtacgac
ggttggttatcctcggctggattcatcggcccgaaggttgaggtcgcccacgacatttcc
ctgctcgtcccggaaatcttctgccggatgtccccggctgagagggatgccaagaccctc
atcgagggtggctatctggagaagctggaagattacgataaagacggcgaactcattctc
gcctcccgtctgggctaccgcatgacggaaaagttcatgcgcacctacttcgggcgtatc
ttcttgcaccccgacaccgtcttcacccctgagatgctgcgtccggagctgcaggacgcc
gacatcttcgctgactcggtgcgaacgatctcgaccactcacgctcgagtggccaaggcc
tatttcgacgacgggacggtctcgctggcggtaccgcccatccgggctctgctggaaatc
atggtcaacggagtttgctcggagggttggactctcgacgatcccgagttgcgggagatg
ttcactcgcgagtcagtacttgcctccgattggtacgccgagcgtatcgacgccaagcag
gccgaagccgtacggcgcgccgagcgaggaatcgcccaccttgagcagttcatggctgat
ccgcgtaacgcgtccgcctgcgaggagattgacgtccaggcccgtctggatcaagtccgc
aagttccacgatcgcgccgtgacggctgagtaccgccaacagttggtgggcactcttggt
cggcaggtcaacttccgctga

DBGET integrated database retrieval system