KEGG   Cutibacterium acnes KCOM 1861 (= ChDC B594): RN83_05110Help
Entry
RN83_05110        CDS       T04624                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
cacn  Cutibacterium acnes KCOM 1861 (= ChDC B594)
Pathway
cacn00020  Citrate cycle (TCA cycle)
cacn00190  Oxidative phosphorylation
cacn00650  Butanoate metabolism
cacn01100  Metabolic pathways
cacn01110  Biosynthesis of secondary metabolites
cacn01120  Microbial metabolism in diverse environments
cacn01130  Biosynthesis of antibiotics
cacn01200  Carbon metabolism
Module
cacn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cacn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cacn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RN83_05110 (sdhA)
   00650 Butanoate metabolism
    RN83_05110 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    RN83_05110 (sdhA)
Enzymes [BR:cacn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     RN83_05110 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     RN83_05110 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C NAD_binding_8 Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: ALD69542
LinkDB All DBs
Position
1103731..1105863
Genome map
AA seq 710 aa AA seqDB search
MNNWVEAVKKPLEMITGRHAGARPEESGAELVKPEQLQPRRAEPSSVARRAAKGSKARDI
LGPAQKKAGYLVGDELDGKAPEGDPLTAWTRRQSEYKLVNPANRRKMNVIVVGTGLSGSG
VAATLGQLGYHVDAFCFHDSPRRAHSVAAQGGINAARARKVDGDSLKRFVKDTVKGGDYR
GREADVVRLGTESVRVIDHMYAIGAPFAREYGGQLATRSFGGVQVSRTYYTRGETGQQLE
VACSQALHAQIDAGSVTMHNRTEMLDLIVADGKAQGIVTRDLLTGEIKAWTAHVVILCTG
GYGSVYHWSTLAKGSNATATWRAHRQGAYFASPCFVQFHPTALPVSSHWQSKTTLMSESL
RNDGRIWVPKKAGDDRPANDIPEEERDYYLERKYPAFGNLTPRDVASRNARTQIESGHGV
GPLKNSVYLDFRDAIERLGKKTIAERYGNLFDMYLDATGENPYEVPMRIAPGAHFTMGGL
WVDYDQMSTIPGLFVGGEASNNYHGANRLGANSLLSASVDGWFTLPLTVPNYLAGFVGKP
VLPLDAPEVSAAIERVQKRTDALLNCGGTHRPEWFHRKLGDILYEGCGVARDEAGLLDAL
TKARELREEFWRDVKVVGTGNRLNQELEKAGRVADFIELGEVMILDALDRRESAGAHFRN
EYATEAGEAKRNDDDWCAVSAWETRPDGTKVRHSEPLSFSLIDLQVRDYR
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgaataactgggttgaggccgtcaagaagcctctcgagatgattactgggcgccatgcg
ggcgccaggcccgaggagtctggcgctgagctggtgaaacccgagcagctccagcccaga
cgggctgagccgtcgtcagtggcgagacgggctgccaaaggttccaaagcccgtgacatc
cttggcccggcgcagaagaaggccggctaccttgttggtgacgaactggacggcaaagct
cccgagggggacccgctcaccgcgtggacccgtcgtcaaagcgagtacaagctcgtcaat
cccgcgaaccgtcgcaagatgaacgtcatcgtggtgggaactggcctctctggttccggg
gttgccgcaactctcggccagctcggttaccacgttgacgctttttgcttccacgactct
ccgcgtcgagcccactcagttgctgcccagggaggtatcaacgctgcacgtgcccgcaag
gtcgacggcgattccctcaagaggttcgtcaaggacactgtcaaaggtggtgattaccgg
ggccgggaggccgacgttgttcgactcggcaccgaatcggtacgggttattgaccatatg
tacgccattggcgccccgttcgcccgagaatatggcggtcagttggctacccgatctttc
ggaggcgtgcaggtttcgcgcacctactacacccgcggagagaccggtcagcagctcgaa
gtagcctgctcccaggccctccatgcacaaattgatgccggttcggtgacgatgcacaac
cgcaccgagatgcttgacctcatcgttgctgacggcaaggctcagggcatcgtcacccgt
gaccttctcaccggcgagatcaaggcatggacggcccacgtcgtcatcctatgcaccggc
ggatatggatcggtgtaccactggtccaccttggccaaagggtccaacgccaccgcgaca
tggcgtgctcaccgtcaaggtgcatacttcgccagcccctgcttcgtgcagttccacccg
accgcgctgcccgtcagttcgcactggcagtccaagaccacgctcatgagcgagtcgttg
cgcaacgacggccggatctgggtgcccaagaaagctggtgatgatcgtccagccaatgac
atcccggaagaggagcgcgactactatctggagcgcaagtacccggccttcggaaaccta
acgccgcgcgacgtcgcctcccgcaatgctcggactcagatcgagagtggccacggagtt
ggcccgcttaagaactcggtgtacctggacttccgtgatgccattgagcgtctaggaaag
aagacgattgccgagcgctacggcaatctgttcgacatgtacctcgacgccacgggggag
aacccctacgaggtgcctatgcgcatcgccccaggagcccattttacgatgggcggtctg
tgggttgactacgaccagatgagtaccatcccgggtctgttcgtcggtggtgaggcgtca
aacaactaccacggcgcgaaccgattgggggccaactccttgctgtcggccagtgtcgat
gggtggttcaccctgccactgacggtgccgaactatttggctgggttcgtcggaaagccc
gtgttacccctggacgcccccgaggtcagcgcagccattgagagggtgcagaagcgcact
gatgccttgctcaactgcggcggaacacaccgcccggaatggttccaccgcaagctcggc
gacatcctctatgaggggtgcggggtcgcccgcgacgaggccgggctgctcgacgccctt
acaaaggcgcgcgagctgcgtgaggagttctggcgtgacgtcaaggtggtcggaacggga
aaccgactcaaccaggaactcgagaaggccggtcgagtggccgacttcatcgagctcggc
gaggtcatgattcttgacgccctggaccgccgggaatcggcaggtgcacacttccgtaac
gagtacgccaccgaagccggtgaagccaaacgtaatgacgatgactggtgtgcggtttcg
gcatgggagacacgccctgatggcaccaaggtgcggcatagcgaaccgttgtcgttctcg
ttgatcgatctgcaggtgagggattaccgatga

DBGET integrated database retrieval system