KEGG   Cutibacterium acnes KCOM 1861 (= ChDC B594): RN83_05115Help
Entry
RN83_05115        CDS       T04624                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
cacn  Cutibacterium acnes KCOM 1861 (= ChDC B594)
Pathway
cacn00020  Citrate cycle (TCA cycle)
cacn00190  Oxidative phosphorylation
cacn00650  Butanoate metabolism
cacn01100  Metabolic pathways
cacn01110  Biosynthesis of secondary metabolites
cacn01120  Microbial metabolism in diverse environments
cacn01130  Biosynthesis of antibiotics
cacn01200  Carbon metabolism
Module
cacn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cacn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cacn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RN83_05115
   00650 Butanoate metabolism
    RN83_05115
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    RN83_05115
Enzymes [BR:cacn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     RN83_05115
    1.3.5.4  fumarate reductase (quinol)
     RN83_05115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_7 Fer4_8 Fer4_10 Fer4_9 Fer4_17 Fer4 Fer4_4 Fer4_2 Fer4_6 Fer4_21 Fer4_18 Fer4_16 Fer4_15 Fer4_3 Fer2 Fer4_22
Motif
Other DBs
NCBI-ProteinID: ALD69543
LinkDB All DBs
Position
1105860..1106618
Genome map
AA seq 252 aa AA seqDB search
MKVELDIWRQNGPDAKGHFEHHVVEDAEPEWSLLELLDRLNDQIVENDGDPIVFESDCRE
GVCGCCGFMVNGKPHGPLPNTPACRQHLRAFPRITHFKIEPFRSAAFPVIRDLAIDRTSM
DHLIQGGGTVDVMTGTAPDADSVPQPHAEAEQALDFASCIGCGACVAACPNGAAMLFAGA
KLSHLAMMPQGRQERSKRARRMINALDEEFGPCSLYGECVEACPVSIPLVAVARVNRERW
RAGFRGARSKDN
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtggaactggatatttggcgtcagaacggccctgacgccaaaggacattttgag
caccacgttgtcgaagatgccgagccggagtggagcctgctggaattgctcgaccggctc
aacgatcagatcgtcgaaaatgacggtgatccgattgttttcgagtctgattgtcgtgag
ggggtgtgcgggtgctgtgggttcatggtcaacggcaagccccatggtccgctgccgaat
actccggcgtgtcgtcagcatttgagggcattcccccgtatcacccacttcaaaattgag
ccattccgctcggcagcctttccggtcatccgtgacctagccatcgaccgcacgagcatg
gaccacctgatacagggcggtggaacggtcgacgttatgacgggcacagcccctgatgca
gattcggtgccgcagccgcatgccgaggccgagcaagctctcgacttcgcatcgtgtatt
ggatgcggagcgtgcgtggcggcttgtccaaatggcgcggcgatgcttttcgccggcgcg
aagctgtcgcacctggcgatgatgccgcaggggcgtcaggagcgttcgaagcgtgcgcga
cgcatgatcaacgcccttgatgaggagtttggcccgtgttccctgtatggcgagtgcgtt
gaggcctgcccggtgagtattccgttggtagccgtcgcccgggtcaaccgggagcgttgg
cgtgccggattccggggagcacgcagtaaggacaactga

DBGET integrated database retrieval system