KEGG   Cutibacterium acnes KCOM 1861 (= ChDC B594): RN83_10265Help
Entry
RN83_10265        CDS       T04624                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
cacn  Cutibacterium acnes KCOM 1861 (= ChDC B594)
Brite
KEGG Orthology (KO) [BR:cacn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RN83_10265
Enzymes [BR:cacn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     RN83_10265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like Thi4 FAD_binding_3 DAO NAD_binding_8 FAD_oxidored Glutaredoxin K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: ALD70370
LinkDB All DBs
Position
2219933..2221507
Genome map
AA seq 524 aa AA seqDB search
MLDNALTTQLKTYLEMVREPIVLVPSPYRGDDAAKSSKSAHMDELLSEIAALSDQVSVGE
PVDNERTPSFAITRPGIPIDVRFAGLPMGHEFTSLVLALLQVGGHPVKEEQSLIDAVRAV
KGEHHFVTYMSLTCQNCPTVVQALNAMAVLNPNIHHTAVDGGTHTDEVEAKGIASVPAIY
LDGEDWGSGRMDMAEILERLDADAAQGAKEDLSQRDPYDVLVVGAGPAGAAAAVYTARKG
IRTAMVGSRIGGQVLDTEAIDNLISVPHTTGPRLADALRSHVNDYNIDVIERQTASAIET
TGGMTTVHLTDGDLRARSVIVATGARWRNLGVPGEEEYRTKGVTYCPHCDGPLFTGKKVA
VVGGGNSGIEAAIDLAGVVDHVTVVEFLDALKADDVLLRTLNSLPNVDVITSARTTQILG
DGSKVTGLEYEDRTSGDVKTIELAGVFVQIGLLPNTEWLEGALERNQRGEIVIDERGTTS
APGVFAAGDCTTQPYKQIIISMGAGATAALGAFDHLIRQNPTQN
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgcttgataacgccctgaccactcagctcaagacctacctcgagatggtgcgcgaaccg
atcgtcctggtgccttccccataccggggtgacgacgccgccaagtcgtcaaagtcggct
cacatggacgagcttctatccgagatcgccgccttatctgaccaagtgagcgtcggtgag
cccgtcgacaatgagcgcaccccctcctttgccatcacccgccccggaatccccatcgac
gtccgctttgcgggcctgccgatgggtcacgaattcacctccctcgtgctggccctgctg
caggtaggtggacaccccgtcaaggaggagcagtccctcatcgacgccgtgcgcgcagtc
aaaggtgagcaccacttcgtcacctacatgtcactaacctgccaaaattgcccgacggta
gtgcaggccctcaacgcaatggccgtcctcaacccgaatattcaccacaccgccgttgac
ggtggcacccacaccgatgaggtagaagccaaaggaatcgcctcggtgccggccatctac
ctggacggcgaggactggggctccgggcgcatggacatggccgaaatcctcgagcgtctc
gacgccgacgccgcccagggagccaaggaagacctctcgcagcgcgacccctacgacgtg
ctcgtcgtaggggcgggtcccgccggtgccgcggccgccgtgtacacggctcgtaagggc
attcgcaccgccatggtcgggtctcggatcggcggccaggtactcgataccgaggccatc
gacaacctcatctcggtgccgcacaccaccggtccgcgtctggccgacgccctccgcagc
cacgtcaacgactacaacattgacgttattgagcgtcagaccgccagcgccatagagacc
accggcggtatgaccaccgtgcatctgaccgacggcgacctgcgggcgcgctcagtcatc
gtggccaccggtgcccgctggcgcaaccttggcgtacctggcgaggaggaataccgcacc
aagggtgtgacctactgcccgcactgcgatggcccgctattcacaggcaaaaaggtggcc
gtcgtcggaggtggaaactccggtattgaggccgctatcgacctcgccggcgtcgtcgac
cacgtcaccgtcgtggagttcctcgacgccctcaaggctgacgacgtactactacgcacc
ctgaactcactaccgaacgtcgacgtcatcacctcggcccgcaccacccagatcctcggc
gacggatccaaggtgaccggtctggagtacgaggaccgcaccagcggcgacgttaagacc
atcgagctagcaggtgtgtttgtccaaatcggtctgctacccaacaccgaatggctcgaa
ggtgccctggagcgcaaccagcggggagaaatcgtcatcgacgagcgtggcaccacctca
gcccccggcgttttcgccgccggtgactgcaccactcagccgtacaagcagatcatcatc
tcgatgggggccggcgccaccgctgctctgggcgccttcgaccacctcatccgtcaaaat
ccgacacagaactga

DBGET integrated database retrieval system