KEGG   Cutibacterium acnes KCOM 1861 (= ChDC B594): RN83_11635Help
Entry
RN83_11635        CDS       T04624                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cacn  Cutibacterium acnes KCOM 1861 (= ChDC B594)
Pathway
cacn00010  Glycolysis / Gluconeogenesis
cacn00030  Pentose phosphate pathway
cacn00051  Fructose and mannose metabolism
cacn00052  Galactose metabolism
cacn00680  Methane metabolism
cacn01100  Metabolic pathways
cacn01110  Biosynthesis of secondary metabolites
cacn01120  Microbial metabolism in diverse environments
cacn01130  Biosynthesis of antibiotics
cacn01200  Carbon metabolism
cacn01230  Biosynthesis of amino acids
cacn03018  RNA degradation
Module
cacn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cacn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RN83_11635
   00030 Pentose phosphate pathway
    RN83_11635
   00051 Fructose and mannose metabolism
    RN83_11635
   00052 Galactose metabolism
    RN83_11635
  09102 Energy metabolism
   00680 Methane metabolism
    RN83_11635
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    RN83_11635
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:cacn01009]
    RN83_11635
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:cacn03019]
    RN83_11635
Enzymes [BR:cacn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RN83_11635
Protein phosphatases and associated proteins [BR:cacn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     RN83_11635
Messenger RNA biogenesis [BR:cacn03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     RN83_11635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ALD70924
LinkDB All DBs
Position
2506347..2508593
Genome map
AA seq 748 aa AA seqDB search
MRLTPTLPDGHGLRIGILTSGGDAQGMNAAVRAVVRSALSVGAEVYAIYEGYQGMIDGGD
GICRFGWDDVGSILNRGGTVIGTFRCKGMRERPGRLKAVRNLLEHGIDRLVVIGGDGSLT
GLDVLRTEWTDLVAELVDTGQVSAEVAREHPALMIAGLVGSIDNDLVGSDMTIGADTALH
RIVDAIDDLASTAASHQRSFVVEVMGRHCGYLALMAAVAGGADYVLIPERPPEDGWEDRM
CAELKRGRQAGRRDSIVVVAEGATDRSGNRISSEYVRQVLEDKLGEDARVTILGHVQRGG
RPSAYDRWASTWLGYHAVHEVLSTTPEAEGRVIGTGSNRIHRLPLVKAVADTKSVPGLIT
EGRYNEAMRMRGRSFVEMDAIFTELSEPARTTSDTAGDADRKRVAIMHAGGPAPGMNTAA
RAAVRLAISRGHTVVGIHNGFIGLATGDMSELAWSDVEGWAGEGGAELGTRREIPSTRDL
YAVSRALEDHHIDALLVIGGYSAYEGIYTMMTERDRYPAFRIPTVCIPASIDNNLPGSEL
SIGTDTALNVIVEAMDKIKESGIASRRCFVVETMGRDCGYLALMSGIAAGAERIYTNEDG
ISLDDLANDVHWLRELFAHGRRLFLAVRNENASHNYTTDFIARLLEEESHGMYDVRQVVL
GHMQQGGSPSPFDRLLANRLGYRALNLIDDELAAHQDGSWFIGVNESGMRPCSMDTMPSL
IDAAHRRPREQWWLQLRTIARMVSDEVR
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgaggctcacccccactctccccgacggtcatggtctgcgcattggcatcctgaccagc
ggtggcgacgctcagggcatgaacgctgctgtgcgggctgtggtgcgctctgcgctaagt
gtgggagccgaggtctatgcgatatacgagggctaccagggaatgatcgatggtggcgat
ggcatctgtaggttcgggtgggacgacgtcggctcgatcctcaaccgtggcggcaccgtg
atcggaaccttccgttgcaaggggatgcgcgaacgtccggggcgcctgaaggctgtcaga
aatctcctcgaacacgggatcgatcgtctcgtcgtcatcggcggtgacggttcgctcacc
ggcctggatgtgctgcgcaccgagtggacagacctggtcgctgaactcgtcgacaccggc
caggtgagcgccgaggtagcccgggaacaccccgccctcatgatcgccgggctcgtcgga
tccatcgacaatgacctcgtcggatccgatatgaccatcggtgccgatactgctctgcac
cgtattgtcgatgccatcgacgacctcgcctccaccgcagccagccaccagcgatccttc
gtcgttgaggtgatgggccgccactgcggctatctcgcccttatggcagcagttgccggc
ggggctgactatgttcttattccggaacggccgcccgaggacggttgggaggaccgcatg
tgcgccgagctcaaacgtggccgtcaggcgggtcgacgcgactcgatcgtcgtcgtcgcg
gagggcgccaccgatcgttccgggaaccggatctcctcggagtacgtccgccaggtgctt
gaggacaaactcggtgaggacgcccgggttaccatcctgggccacgtccagcgcggcgga
cgaccgtcagcctatgaccgctgggcgtcgacctggttgggttatcacgcggttcacgag
gtgctctcgaccactccagaggccgaggggcgcgttatcggtactgggtccaaccgcata
catcgcctccccctggtcaaggccgtcgctgacacgaagtcggtgcccggtctcattacg
gagggccgttacaacgaggccatgcggatgaggggacgttcctttgtcgagatggacgcg
atcttcaccgaactcagtgaaccagctcgtaccacttccgacaccgctggtgacgccgac
cgcaagcgcgtcgcgatcatgcacgctggcggtccggccccgggcatgaatactgctgcc
cgtgctgcagtgcgactggcgatttcccgcggtcataccgttgtgggaatccataacggg
ttcatcggactagcgaccggggacatgtcggaattggcctggagcgacgtcgagggctgg
gccggggaaggcggcgctgagctgggtacccgccgcgagatccctagcactcgcgacctt
tatgctgtcagccgcgctctggaggatcatcacatcgacgcgttgctcgtcattggtggc
tactcggcctacgaaggtatctacaccatgatgactgagcgggaccggtacccggctttc
cgtattccgacggtgtgcatcccggcttctatcgacaacaacctccccggttcggaactg
tccatcggcaccgacaccgctctcaacgtcatcgtcgaggcgatggacaagattaaggag
tcgggtatcgcgtccagacgctgcttcgtcgtcgagacgatgggtcgtgactgcggatac
ctcgcgttgatgtcgggtatcgcagctggcgctgagcggatctataccaacgaggacggc
atctccctggacgatctagccaacgacgtccattggttgcgggagttattcgcccacgga
cgacgacttttccttgccgtgcgcaacgagaacgcatcgcacaattacaccaccgacttc
atcgcgcggctgctggaggaggaatcacacggcatgtatgacgtacgccaggtggtacta
gggcatatgcagcaaggcggctcgccctcacctttcgaccgcttgctcgccaaccgactc
gggtatcgcgctctcaatctcatcgacgacgagttggcggcgcatcaggacggttcatgg
ttcattggcgtcaacgagtcaggcatgcggccctgttcgatggacaccatgccctctctc
attgacgccgctcatcgtcgtccccgcgaacagtggtggctgcaactgaggactattgcc
aggatggtctcggacgaggtgcggtaa

DBGET integrated database retrieval system