KEGG   Gottschalkia acidurici: Curi_c13640Help
Entry
Curi_c13640       CDS       T02255                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase, Fe
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cad  Gottschalkia acidurici
Brite
Enzymes [BR:cad01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Curi_c13640 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C MetOD2
Motif
Other DBs
NCBI-ProteinID: AFS78374
UniProt: K0AYP0
LinkDB All DBs
Position
complement(1462868..1463557)
Genome map
AA seq 229 aa AA seqDB search
MKNSSKNTINIKQFNFNNVKGISRNQLDQHYELYKGYVRNINKIWDILDQTPEFNDSNPT
YSPLRCLRLGETYALDGVKLHELYFENLNSNYNRPFGPIVDLIIRDFYSFERWENLFKQT
GLAMRGWVVLAIDHIDKRLHIYGQDEHDKGSIWMAHPLLVLDVYEHAYMIDFGIDRKKYI
DIFMENIDWNIVNQRLEMFMLKHSNNNHNMSNYYCNYNYDPYMYYYDYR
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatagttcaaaaaatacaatcaatattaagcaatttaattttaataatgtaaaa
ggaatctccagaaatcaattagatcaacattatgagctttataaaggatatgtcagaaat
atcaataaaatttgggatatacttgatcaaactcctgaatttaatgactcaaatcctact
tatagtcctcttcgttgtctaagactaggagaaacttatgctctagatggagttaaatta
catgagttatattttgaaaacctaaatagtaattataatcgtccattcggacctatagtt
gatcttataataagagatttctatagttttgaacgatgggaaaatttgtttaagcaaact
ggtttggctatgagaggatgggtagtattagccatagatcatattgataaaagacttcac
atatacggtcaggatgaacatgataaaggctctatttggatggcacatcctttattggtt
ttagatgtatatgagcatgcttatatgatcgacttcgggatagatagaaagaaatatata
gatatttttatggagaatatagattggaacattgttaatcaaagacttgaaatgtttatg
cttaaacacagtaataataatcacaatatgagtaattattactgtaactataattacgac
ccttatatgtattattatgattatagatag

DBGET integrated database retrieval system