KEGG   Gottschalkia acidurici: Curi_c16780Help
Entry
Curi_c16780       CDS       T02255                                 

Gene name
sps
Definition
(GenBank) serine/threonine-protein kinase Sps
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cad  Gottschalkia acidurici
Brite
KEGG Orthology (KO) [BR:cad00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cad01001]
    Curi_c16780 (sps)
Enzymes [BR:cad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Curi_c16780 (sps)
Protein kinases [BR:cad01001]
 Serine/threonine kinases: Other
  Bacterial family
   Curi_c16780 (sps)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like Kdo RIO1 DUF2613 Fructosamin_kin
Motif
Other DBs
NCBI-ProteinID: AFS78685
UniProt: K0B157
LinkDB All DBs
Position
complement(1753047..1755071)
Genome map
AA seq 674 aa AA seqDB search
MSDKMIGRVLGNRYEIVEKVGSGGMASVYKAKCSLLNRFVAVKILKEEYINDEEFIEKFR
REAQAAASLSHPNIVNVYDVGVEDDIYYIVMEYINGKTLKEIIVDKGKLDTKETIDIGMK
VADAISHAHANKVIHRDIKPHNIMVTEDGRVKVTDFGIARAATSSTITSTNSVMGSVHYF
SPEQARGGYTDEKSDIYSLGIMMYEMCTGVLPFQGDSPVAVAIKHIQEEVVPPTQIDSSV
SPDLERVIMKCIEKNQSLRYSSAIELLQDLKNIRDGVRNVNTEKALNLNDSPTQIIPKLD
ETMIMNSDNDNEGKNNMDNKKTINSNNNKKKKPKKKSNKWVTISAVLLAFLVVALGAGVA
LGLSGMLSNNDIPTPDLVGKTKSEAEIEVQKRGLKLKVESEKESDKKEGTIIEQIDEKGK
KVKKGYPVRVIISKGRSVDLTKVPDVREKSIGKAEDMIEEAGLEVLRVDYEYSDKPEGIV
IDQTPRAGKEVEQGTEVIIVVSKGKKTTTTTVPSLRDLKEEEAIIELSAYGLGVGSVDYE
NSDIEKGKVVSQNPKAGREVEENSKVNIVISKGPKEEEKDKNKNNESNNNTNNNSNNNSN
NKEKTIMESIKLPTANEEVNVMIEMEQDGASGIIHNQNYKTSNPNIKVPITGKGTAKINI
YIDGELYGSREIKF
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgagtgataaaatgataggtagagtcttaggtaataggtatgaaatagttgaaaaagtt
ggctcaggcggtatggcctcagtttataaagctaagtgtagcctacttaacagatttgta
gcagtaaagatattaaaagaagaatatataaacgatgaagaatttatagaaaaatttaga
agagaagcgcaggctgcagctagtttatcacatcctaatatagtaaatgtatatgacgta
ggggtcgaagatgatatatactatatagtaatggagtatataaatggaaaaacgcttaaa
gaaattatagtagataaaggaaaacttgatactaaagaaacaatagatatagggatgaaa
gtagcagatgcgataagtcatgctcatgctaataaagtaatacacagggatataaaacca
cataacattatggttacagaagatggaagagtaaaagtgacagactttggtatagctaga
gctgctactagttcaactattactagtacgaatagtgtaatgggatctgtacattatttt
tcaccagaacaagctagaggaggctatacagacgaaaaatcagatatatattctctagga
attatgatgtatgaaatgtgtacaggagttttaccatttcaaggggatagtccagtagct
gttgcaataaagcatatacaagaagaagtagtacctcctactcaaattgatagctctgtt
tcaccagatttagaaagagtaataatgaaatgtattgagaagaatcaaagtttaagatac
agtagtgcaatagagctattacaggatcttaaaaatataagagatggtgtcagaaacgta
aatacagaaaaagcattaaatttaaatgattcccctactcaaataatacctaaattagat
gaaactatgataatgaacagtgataatgataatgagggtaaaaataatatggataataag
aaaactataaatagtaacaataataagaagaaaaaaccgaaaaagaagtctaacaagtgg
gtaaccataagtgcagtacttttagcttttttagttgtagcattaggagctggagtagct
ttaggattaagcggtatgctatcaaataacgatatacctactccagatttagtaggcaaa
acaaaatctgaggccgaaattgaagttcaaaagcgtggactaaaacttaaagttgaaagt
gaaaaagaaagtgacaaaaaggaaggtactataatagaacaaatagatgaaaaaggtaaa
aaagttaaaaaaggctatccggtaagggttattataagtaaggggagatctgtggactta
acaaaagttccagacgtaagagaaaaatctataggtaaagcagaagatatgatagaagaa
gctggattagaggtattaagagtggactatgaatatagtgataaacctgaaggtattgtt
atagaccaaacaccaagagcaggaaaagaagtagaacaaggaacagaagtaattatagtg
gtaagtaagggtaagaaaacgactactacaacggtacctagtcttagagatttaaaggaa
gaagaggctataatagagttatcagcatatggtcttggagtaggatcagtagattatgag
aatagtgatattgaaaagggtaaagtagtatcccagaatcctaaagcaggaagagaagta
gaagaaaattctaaagtaaacatagttataagtaaaggtcctaaagaagaagaaaaagat
aaaaataaaaacaatgaatcaaataacaatacgaataataattcaaataataactcaaat
aataaagaaaaaacaattatggaatctataaagttacctacagctaatgaagaagtaaat
gtaatgatagaaatggagcaagatggtgcatctggtataatccataatcaaaattacaag
acttctaatccaaatataaaggttccgataacgggtaaaggaacagccaaaataaatata
tatatagatggagaattgtatggaagtagagaaataaaattttag

DBGET integrated database retrieval system