KEGG   Gottschalkia acidurici: Curi_c20820Help
Entry
Curi_c20820       CDS       T02255                                 

Gene name
alr
Definition
(GenBank) alanine racemase Alr
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cad  Gottschalkia acidurici
Pathway
cad00473  D-Alanine metabolism
cad01100  Metabolic pathways
cad01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cad00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Curi_c20820 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Curi_c20820 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cad01011]
    Curi_c20820 (alr)
Enzymes [BR:cad01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Curi_c20820 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:cad01011]
 Precursor biosynthesis
  Racemase
   Curi_c20820 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C CAMSAP_CH
Motif
Other DBs
NCBI-ProteinID: AFS79086
UniProt: K0B372
LinkDB All DBs
Position
complement(2189372..2190553)
Genome map
AA seq 393 aa AA seqDB search
MIMNTLEEIRPAWAEIDLDNLSYNLSQIKKLVSDSTEIMAVVKANAYGHGAIEISKVFLE
EGVNKLAVATLSEAIELRNAGIDAEILILGYTPKSQLRSIIKYNITQTIYNYEAAYELSE
IAKEMNKICNIHIKIDTGMSRLGYRTEDEDIKNIIKISKLSNIFIEGIFSHFSTADESDK
LFVEQQYREFMLMINNLEKNNIYIPIKHISNSASIIDLPEYNLNLVRPGIILYGLYPSNE
VKKDNIKLKPVMTLKAKISNVKIIPKETGVSYGRTYITDKETTIATIPIGYADGFTRMLI
DKGSMLINGKKAKVVGRVCMDQCMLDVTGIEDVYIGQEVIIFGNDEKANSVDEIADELKT
INYEILCMVSRRIPRVYKKHNEIVKIVDYLVHS
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgattatgaatactttagaagagattagaccagcatgggcagaaattgatttagataat
ttatcttataatttgagtcaaataaaaaaactagttagtgattcaactgaaattatggca
gtggttaaagcaaatgcatatggacatggagctatagaaattagtaaagtttttttagaa
gagggggtaaataagttagctgttgctactctctcggaagcaattgaacttagaaatgct
ggtatagatgcagaaatactaatactaggttatactcccaaaagtcaacttcgatctata
ataaaatacaatattacacaaactatatataactatgaagctgcatatgaattatctgaa
attgcgaaagaaatgaataaaatttgcaatattcatattaaaatagatacaggaatgagt
agattagggtatagaacagaagatgaagatataaaaaatattataaagataagtaaacta
tcgaacatatttattgaaggtatattttcccacttttctactgctgatgaaagtgataag
ctatttgttgagcaacaatatagagaatttatgttaatgattaataatctagaaaaaaac
aatatatatataccaataaagcatatatccaatagtgctagtataatagatttaccagaa
tacaacttaaatttagtaagaccaggtattatactttatggactttatccatctaatgaa
gttaagaaagacaacattaagttaaagccagtaatgacattgaaagccaagatatctaat
gtgaaaataattccaaaggaaacaggagtaagctatgggaggacatatattacagataaa
gaaacaactatagcgactattccaataggctatgcagatggatttacaagaatgcttata
gataaaggaagtatgttaattaatgggaagaaagctaaagtggtaggtagagtttgtatg
gatcagtgtatgctagatgttacaggtatagaagatgtatatataggtcaagaggttatc
atatttggaaatgatgaaaaagcaaatagtgtagatgaaatagcagatgaattaaaaact
ataaattatgaaattctatgtatggttagcagaagaattccaagagtatataaaaagcat
aatgaaatagtaaagattgtagactatttagtgcattcttag

DBGET integrated database retrieval system