KEGG   Gottschalkia acidurici: Curi_c23940Help
Entry
Curi_c23940       CDS       T02255                                 

Definition
(GenBank) cell envelope transcriptional attenuator family protein
Organism
cad  Gottschalkia acidurici
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LytR_cpsA_psr
Motif
Other DBs
NCBI-ProteinID: AFS79389
UniProt: K0B1Q6
LinkDB All DBs
Position
complement(2513370..2514332)
Genome map
AA seq 320 aa AA seqDB search
MSRFLRTFLFSLVCFSLFAIGGITAYFKIFDSEVTIPQDQVDKLDLSDKDPFERAILESK
RVNGILLGVNEGMTDTIMFCSLDTENKKMDIISIPRDTFYHRKGYNGAADKKINAAYSSQ
GIDAVLGGVQNLLGDKVPIHHYGIIDYKGVEKIVDLVGGVEVDVPINMRYDDPYDKPPLR
IRISKGRQVLDGKKAMEFLRFRQNNDKTGYPDMDLGRVKAQQQFMTAFLKKAIGLKLPNI
IKTGFKYIETDVNISDGLSYGSKVIGIGSEDMNATTLPGEPRYIGSTSYFIHDPDETEKL
IKQLYGVSEVDETQTEDDDI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgagtaggtttttaagaacttttttattttctttagtatgtttctctctatttgctata
ggtggaataactgcatactttaagatatttgattcagaagtaaccataccacaagatcaa
gtggacaagctagatttaagcgataaagatccttttgaaagagccatattagaaagcaaa
agagtaaatggaatactactaggagtaaatgaaggtatgacagatacaataatgttttgt
agtcttgatactgaaaataaaaagatggacataatatctattcctagagatactttttat
catagaaaaggatataacggggcagccgacaagaagataaatgcagcttatagtagtcaa
gggatagatgcagttttaggtggagtacaaaatttactaggcgataaagtgcctatacat
cattatggaataatagactataaaggagtagaaaagatagttgacttggtaggtggtgta
gaagtagacgtacctataaatatgagatatgatgatccttatgataaaccaccactaaga
atacgtatatctaaaggtagacaagtactagatggtaaaaaagctatggaatttttgagg
tttagacagaataatgataagacaggatatccagacatggatttaggtagagtgaaggct
caacaacaatttatgacggcatttttaaaaaaggcaataggattaaaattacctaatatt
ataaagacaggatttaaatatatagaaactgatgtaaatatatctgatggactatcttat
ggaagtaaagtaataggaataggtagtgaggatatgaatgctacgactttaccaggagaa
ccaagatatataggatcaacatcatactttattcatgatccagatgaaactgaaaaactt
atcaagcaactttatggtgtaagtgaagtagatgaaacacagactgaagatgatgatata
taa

DBGET integrated database retrieval system