KEGG   Gottschalkia acidurici: Curi_c25040Help
Entry
Curi_c25040       CDS       T02255                                 

Gene name
aor
Definition
(GenBank) tungsten-containing aldehyde:ferredoxin oxidoreductase Aor
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
cad  Gottschalkia acidurici
Pathway
cad00030  Pentose phosphate pathway
cad01100  Metabolic pathways
cad01120  Microbial metabolism in diverse environments
cad01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Curi_c25040 (aor)
Enzymes [BR:cad01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Curi_c25040 (aor)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N Endonuc-FokI_C
Motif
Other DBs
NCBI-ProteinID: AFS79499
UniProt: K0B203
LinkDB All DBs
Position
2624040..2625866
Genome map
AA seq 608 aa AA seqDB search
MYGYMGKVLRVDLTKGTCLYEDLNMENAKNFIGARGLGVKTYIDEVDPNVEAISEENKII
LATGPVTGTIAPTGGRYMVISKAPLTGTIGTANSGGFFGTHLKKSGLDMIIIEGKSKEPV
YLLIENDKAELRSAKHLWGKKLEDTTKTLKSETSDKHKILAIGPAGENLSLMSSIMNDID
RAAGRGGMGAIMGFKNLKAISILGTKTVEVPNKDKFREVAKEKISLIKNDPVGGTGLRAY
GTAVLVNIINENGMHPVKNFKEGYTDLEKIDKVSGETLASDHLTRAVGCASCPISCGREV
KLSNGDIVGGPEYETLWSFGPDCDNYDLDSINVLNMLCNEYGLDTISAGATLAAAMELYE
DGLIKDEELQSDGLSLQWGDKDSMIKWLHKIALREGFGAKMADGSYRLCESYGQIDKSMS
VKKQEIAAYDPRGAKGIGLNYATNNRGGCHIKGYMINPEILGYPVKVDRLSDDKEKSDLT
VIVQNLTAIVDSMGMCIFTTFGLKDNQDYADILNAVCGTNYTGDTLLEVGERIYSLERMY
NERCGFSRADDTLPKRLTDEAMPSGPVKGEIVNLEKMLDNYYISRGWSKDGIVTEETKKR
LGLQDCFA
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgtatggttacatgggaaaagttttacgtgtcgatctgacaaaaggtacatgtttatat
gaagatttaaacatggaaaatgcaaaaaacttcattggagccagaggtcttggtgtaaaa
acttatatcgatgaagttgatccaaatgttgaagctataagtgaagaaaacaagatcata
ttggctacaggtccggttacgggaactatagctccaacaggtggacgctatatggtaatt
tcaaaagctccgctaacaggaactataggaacagcaaattctggaggattttttggtaca
catctgaaaaaatctggacttgatatgattattatcgagggaaaatctaaagagcctgtt
tatttactaattgaaaatgacaaagcagaacttcgtagtgcaaagcatttatggggaaaa
aaattagaagacactacaaaaactctaaaatcagagacaagtgataagcacaaaatacta
gcaataggaccagctggtgaaaatttatcgctgatgagttctattatgaatgatattgat
agagctgctggcagaggtggtatgggagctataatgggatttaagaatttaaaagccata
tctattctaggtacaaaaacagttgaagttcctaataaagataagtttagagaagtagca
aaagaaaaaattagtttgattaagaatgaccctgttggtggtacgggattacgtgcttat
ggtacagcagttcttgtaaatataattaatgaaaatggtatgcatcctgttaagaatttt
aaggaaggatacactgatttagaaaaaatagataaagttagtggtgaaactttagctagt
gatcatctaacaagagcagtaggttgtgcttcttgccctatttcttgcggacgtgaagta
aaactttcaaatggtgatatagtaggtggtccagaatatgaaactctatggtcatttgga
ccagactgtgataactatgatctagactctatcaatgttcttaatatgttatgtaatgag
tatggattagatacaatatcagcaggggcaactcttgcagctgctatggaactatatgaa
gatggattaataaaggacgaggaactacaaagtgatggattaagtcttcagtggggcgac
aaagattctatgataaagtggctacacaaaatagcacttagagaaggttttggagctaaa
atggcagatggttcatatagactttgtgaaagctatggtcagatagataaaagtatgagt
gttaaaaaacaagaaattgcagcttatgacccacgtggggcaaaaggaatcggacttaac
tatgcaactaataatagaggcggttgccacattaaaggttatatgattaacccagaaatt
ttaggttatcctgtaaaagtggatagactctcagatgataaggaaaaatcagatttaact
gttatagttcagaacttaacagcaatcgttgattctatgggtatgtgcatatttactact
ttcggacttaaagataatcaagactatgcggatattttaaatgctgtatgtggtacaaat
tatacgggagatactctattagaagttggtgaaagaatttattcattagagcgtatgtat
aatgaaagatgtggtttttcacgtgctgatgatacacttcctaagagattaactgatgaa
gctatgccaagtggcccagtaaaaggtgaaatagtgaacttagaaaaaatgcttgataac
tattatatatcacgtggttggtcaaaagatggtatagttacagaagaaactaaaaaacgt
cttggcttacaagattgtttcgcataa

DBGET integrated database retrieval system