KEGG   Clostridium acetobutylicum DSM 1731: SMB_G0085Help
Entry
SMB_G0085         CDS       T01548                                 

Definition
(GenBank) MutT/NUDIX family hydrolase
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
cae  Clostridium acetobutylicum DSM 1731
Brite
KEGG Orthology (KO) [BR:cae00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cae03400]
    SMB_G0085
Enzymes [BR:cae01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     SMB_G0085
DNA repair and recombination proteins [BR:cae03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    SMB_G0085
 Prokaryotic Type
    SMB_G0085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-ProteinID: AEI31059
LinkDB All DBs
Position
93048..93524
Genome map
AA seq 158 aa AA seqDB search
MDQLRYTICFIKREDEVLLLNREKPSWMGSWNGVGGKFQNSETPMECILREIHEETGMKF
QEAKFKGIVTWDEGDKDIGGMYLFLIEVPANYNYSVPVKTREGILDWKKISWVMNPENTG
IAANVPKYLPKMLKEEGEFRYHCVFKNKMLLGVNIEEI
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggatcaacttaggtataccatttgttttataaaaagagaagatgaagtgcttctttta
aatagagaaaagcctagctggatgggaagttggaatggtgttggaggaaagtttcaaaat
agtgaaactccaatggaatgcatacttagagagatacatgaagagacaggaatgaagttt
caagaggccaaatttaaaggcatagttacatgggatgaaggagataaagatattggtggc
atgtatctttttttgatagaggttcctgcaaattataattattctgtaccagtaaaaaca
cgagaagggattttagattggaaaaagatatcttgggtaatgaatcctgaaaatactgga
attgcagcaaatgtacctaaatatcttcctaagatgcttaaggaagaaggcgaatttaga
tatcattgtgtttttaaaaataaaatgcttctaggggttaacatagaagagatttga

DBGET integrated database retrieval system