KEGG   Clostridium acetobutylicum DSM 1731: SMB_G0528Help
Entry
SMB_G0528         CDS       T01548                                 

Gene name
pykA
Definition
(GenBank) pyruvate kinase (pykA)
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
cae  Clostridium acetobutylicum DSM 1731
Pathway
cae00010  Glycolysis / Gluconeogenesis
cae00230  Purine metabolism
cae00620  Pyruvate metabolism
cae01100  Metabolic pathways
cae01110  Biosynthesis of secondary metabolites
cae01120  Microbial metabolism in diverse environments
cae01130  Biosynthesis of antibiotics
cae01200  Carbon metabolism
cae01230  Biosynthesis of amino acids
Module
cae_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cae_M00002  Glycolysis, core module involving three-carbon compounds
cae_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
cae_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cae00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMB_G0528 (pykA)
   00620 Pyruvate metabolism
    SMB_G0528 (pykA)
  Nucleotide metabolism
   00230 Purine metabolism
    SMB_G0528 (pykA)
Enzymes [BR:cae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     SMB_G0528 (pykA)
Membrane trafficking [BR:cae04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SMB_G0528 (pykA)
Exosome [BR:cae04147]
 Exosomal proteins
  Proteins found in most exosomes
   SMB_G0528 (pykA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AEI33632
LinkDB All DBs
Position
597261..598682
Genome map
AA seq 473 aa AA seqDB search
MQKTKMIFTVGPASETEEIVTAFIKAGMNASRHNFSHGDHAEHGGRIALVKKVRAKLNKP
VAICLDTKGPEIRTGDFNPSKLELQKGSKFTIVCGEEIVGDATKCSISYKDLYKDVKPGN
TILIDDGLVGLTVEAIEGTNVICTVANTGLVGSHKGVNVPNVSIQLPAMTEKDKSDLIFG
CKEEIDMVSASFIRKPEDVLAIRKVLNENGGENIQIFSKIENQEGVDNIDAIIEVSDGIM
VARGDMGVEIPIQRVPLIQKMIIKKCNAVGKPVITATQMLDSMMRNPRPTRAEASDIANA
IFDGTDAIMLSGESANGSYPIEAVTTMAKIAQEAENEINYDKFLAERKGNEKKNTSDVIS
LGTCTAAADLEASAIITATQTGSTARTVSKYRPKAPVIAVTPSEKVARKLAMSWGVHPII
SDKFGSTDELISTSVDKALEAGYVQKGDLVVVAAGVPTNVSGTTNMLKVQVVE
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaactaaaatgatttttacagttggaccagcaagtgagacagaggagattgta
acagctttcataaaagctggaatgaatgcttcaagacataacttttcacacggtgatcat
gcagagcacggtggaagaatagctttagtaaaaaaggttagagcaaagcttaataagcct
gtagctatatgccttgatactaaaggaccagaaataagaactggagatttcaatccttca
aagcttgaacttcaaaaaggttcaaaatttactatcgtttgtggcgaagaaatagttgga
gatgctacaaaatgttcaatatcatataaagatttatacaaagatgtaaaaccaggaaac
actatattaatagatgatggtttagttggacttacagtagaagctatagaaggaacaaat
gtaatttgtactgtagcaaatacaggattagttggaagccataaaggagtaaatgttcca
aacgtttcaatacaacttcctgcaatgacagaaaaagataagagcgatttaatattcgga
tgtaaagaagaaatagatatggtaagtgcatcattcataagaaaacctgaagatgtactt
gcaataagaaaagtattaaatgagaatggcggagaaaacattcaaatattctctaaaatt
gaaaatcaagaaggcgtggacaacatagatgctattatagaagtttctgacggaataatg
gtagctagaggagatatgggagttgaaattcctatacaaagagttccattaatccaaaaa
atgataatcaaaaaatgtaatgcagtaggaaaacctgttataacagcaactcaaatgctt
gattcaatgatgagaaatccaagacctacaagagcagaagcttcagatatagcaaatgct
atatttgatggaacagatgctataatgttaagtggagaaagcgctaatggatcatatcca
atagaagctgtaactacaatggcaaaaatagcacaagaggcagaaaatgaaatcaattat
gataaattcctagcagaaagaaaaggaaatgaaaagaaaaatacttctgatgtaataagt
cttggaacttgcacagcagcagcagacttagaagcttcagcaataataactgcaactcaa
acaggaagcacagcaagaacagtttcaaaatatagaccaaaagcacctgtaatagcagtt
actccatctgaaaaagtagcaagaaaacttgcaatgagctggggagtacaccctataata
tctgataaatttggttcaactgatgaacttatctctacttcagtagataaagcccttgaa
gcaggatatgtacaaaaaggagatcttgtagttgtagctgcaggtgtaccaacaaatgta
tcaggtactacaaacatgcttaaagttcaagttgttgagtaa

DBGET integrated database retrieval system