KEGG   Citrobacter amalonaticus FDAARGOS_165: AL524_01275Help
Entry
AL524_01275       CDS       T04738                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
caf  Citrobacter amalonaticus FDAARGOS_165
Pathway
caf00564  Glycerophospholipid metabolism
caf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:caf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AL524_01275
Enzymes [BR:caf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AL524_01275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored Pyr_redox_2 NAD_binding_8 FAD_binding_2 3HCDH_N Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: AMG51832
LinkDB All DBs
Position
179348..180856
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
AGLRFGAESVLKPEIVRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATSARRENG
LWIVEAEDIDTGKTFTWQARGLVNATGPWVKEFFDEGMHLPSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVKIDESEINYLLKVYNAHF
KKQLGRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKLTTYRK
LAEHAMEKLSSYYQGIGPAWTKDCVLPGGEIGGDREDYAARLRRRYPFLTESLARHYSRT
YGSNTEWILGEATSVADLGEDFGHEFYEAELKYLVDHEWVRRADDALWRRTKEGMWLNAE
QQSRMTQWLAEYVAKHQLSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagatctgattgtgatagggggaggcatcaacggtgccggtatcgcggca
gatgccgctggacgcggtttatccgtgctgatgctggaagcgcaagatcttgcgtgcgca
acctcctctgccagttctaaactcatccacggtggcttgcgctacctggaacactacgaa
ttccggctggtgagcgaagcgctggctgaacgcgaagtgctgctgaaaatggccccgcat
attgccttcccaatgcgctttcgcctgccgcatcgccctcacctgcgtccggcatggatg
attcgtattggtctgtttatgtacgatcatttaggtaaacgcaccagcttaccgggttct
gccggtttgcgttttggcgcagagtcggtactgaaaccggaaattgtgcgcggtttcgaa
tattccgactgctgggtcgacgatgcgcgtctggtgctggccaatgcccagatggtggtg
cgaaaaggtggggaagtgttaacccgcactcgtgcaacctctgcgcgtcgcgaaaacggt
ctgtggatcgtcgaagccgaagatatcgataccggtaagacattcacctggcaggcgcgt
gggctggtcaacgccacgggtccgtgggtgaaagaatttttcgacgaaggtatgcatctg
ccttcgccatacggtattcgcctgatcaaaggcagccacatcgtggtgccgcgcgtccat
acccagaaacaagcctacattctgcaaaacgaagataaacgcattgtgtttgttattccg
tggatggatgagttctccatcatcggcaccaccgacgtcgagtacaaaggcgatccgaaa
gcggtaaaaatcgacgaaagcgaaatcaattacctgttgaaagtctataacgcgcacttt
aagaaacagcttggtcgtgacgatatcgtctggacctattccggtgtgcgcccgctgtgc
gacgacgagtcggattcaccacaggccatcacccgcgattacacgctggatattcatgat
gaaaatggcaaagcgccgctgctttctgtcttcggcggtaaactgaccacctaccgtaag
ctcgccgagcacgcgatggagaaactgtcgtcgtactatcagggcattggcccggcatgg
accaaagactgcgtgctgccaggcggtgaaatcggtggcgatcgcgaagactacgcggcg
agactgcgccgtcgttatccgttcctgacagaatcgctggcgcgccattactcacgcacc
tacggcagcaacacagagtggatcctcggcgaagccacctctgtcgcggatttaggcgaa
gatttcggccatgagttctacgaagcagagctgaaatatctggtagaccacgaatgggtt
cgccgtgcagacgatgcgctgtggcgtcgtaccaaagaagggatgtggctcaacgccgaa
cagcagtctcgcatgacccagtggctggcagagtacgtcgcgaaacatcagctttcactg
gcatcgtaa

DBGET integrated database retrieval system