KEGG   Citrobacter amalonaticus FDAARGOS_165: AL524_04085Help
Entry
AL524_04085       CDS       T04738                                 

Definition
(GenBank) superoxide dismutase [Mn]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
caf  Citrobacter amalonaticus FDAARGOS_165
Brite
Enzymes [BR:caf01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AL524_04085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AMG52331
UniProt: A0A0X8S3B6
LinkDB All DBs
Position
808097..808717
Genome map
AA seq 206 aa AA seqDB search
MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLSAEELIAK
LDQVPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKA
AATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIVGLDVWEHAYYLKFQN
RRPDYIKEFWNVVNWDEAAARFAAKK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagttatacactgccatccctgccgtacgcttatgatgcgctggaaccgcacttcgat
aagcagacgatggaaatccaccataccaaacaccaccagacctatgtaaacaacgccaac
gcggcgctggaaagtctgcctgaattcgctaacctgtctgctgaagagctgatcgctaaa
ctggatcaggtaccggccgacaagaaaaccgttctgcgtaataatgcgggcggtcacgct
aaccacagcctgttctggaaaggcctgaaaaagggcactaccctgcagggcgatctgaaa
gcggctatcgaacgtgatttcggctctgttgataacttcaaagcagaattcgaaaaagct
gccgccacccgtttcggttccggctgggcctggctggtgctgaaaggcgacaagctggcg
gtcgtttcaaccgcaaaccaggattccccgctgatgggtgaagcgatttctggtgcgtct
ggcttcccgattgtgggcctggacgtgtgggaacacgcttactacctgaaattccagaac
cgtcgtccggactacatcaaagagttctggaacgtggtgaactgggacgaagcggctgcg
cgtttcgctgcaaaaaaataa

DBGET integrated database retrieval system