KEGG   Citrobacter amalonaticus FDAARGOS_165: AL524_04515Help
Entry
AL524_04515       CDS       T04738                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
caf  Citrobacter amalonaticus FDAARGOS_165
Pathway
caf00620  Pyruvate metabolism
caf00680  Methane metabolism
caf01100  Metabolic pathways
caf01120  Microbial metabolism in diverse environments
caf01200  Carbon metabolism
Module
caf_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:caf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AL524_04515
  09102 Energy metabolism
   00680 Methane metabolism
    AL524_04515
Enzymes [BR:caf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AL524_04515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AMG52409
UniProt: A0A381GG31
LinkDB All DBs
Position
complement(895830..898481)
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKVLGETIKDALGENILDRVETIRKLSKSSRAGNEANRQELLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSSSPKGEGASNPEVIARTLRKLKNQPELNDA
IIKKAVESLSLELVLTAHPTEITRRTLIHKMGEINACLKQLDNKDIVEYERHQLMRRLRQ
LIAQSWHTDEIRKLRPSPVDEAKWGFAVVENSLWQGVPNYLRELNEQLEDNLGYQLPVDF
VPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDIQVLVSELSMVDATPELL
AMVGEEGASEPYRYLMKNLRSRLMATQAWLEARLKGEKLPKPAGLLTQNEQLWEPLYACY
RSLQACGMGIIANGELLDTLRRVKCFGVPLVRIDIRQESTRHTEALGELTRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRNWEPSNDTREVLDTCKVIAEAPKGSIAAYVISMAKTP
SDVLAVHLLLKEAGIGFAMPVAPLFETLDDLNNADDVMTQLLNIDWYRGLIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTVSSLSLYTSAILEANLLPPPEPKDAWRHIMDEL
SVISCDVYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGTALQKVVEDGKQSELEAMCRDWPFFSTRLGMLEMVFSKADLWLAE
YYDQRLVAKALWPLGKELRELLEEDIKVVLAIANDSHLMADLPWIAESIQLRNIYTDPLN
VLQAELLHRSRLTEQQGKEPDPRVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcgttgcgtagtaatgtcagtatgctcggcaaagtgctggga
gaaaccatcaaggatgcgctgggagagaacattcttgatcgcgtagaaacaatccgtaag
ctgtctaaatcctcacgcgctggcaatgaagcaaatcgccaggagttgctcaccacgtta
cagaatttgtcgaatgacgagttgctgccggtcgcacgcgcgtttagccagttcctgaac
ctggccaataccgccgagcaatatcacagcagttcgccaaaaggcgaaggcgccagcaac
ccggaagtgattgcccgcaccctgcgtaaactgaaaaaccagccagagctgaacgacgcc
atcatcaaaaaagcggtagagtcgttgtctcttgagctggtgctgaccgcacatccgacg
gaaattacccgtcgcacactgatccacaaaatgggcgaaatcaacgcctgtctgaagcag
ctcgataacaaagatatcgttgaatacgaacgccaccagttgatgcgccgtctgcgccag
ctgattgcccagtcctggcacaccgatgaaattcgtaagctgcgcccaagcccggttgat
gaagccaaatggggcttcgcggtggtcgagaacagcctgtggcagggcgtaccgaactat
ttacgcgagctgaacgaacagctggaagataatctgggctaccagttacccgttgatttc
gttccggtccgtttcacctcatggatgggcggcgaccgtgacggcaacccgaatgtaacc
gcagatatcacccgccacgttctgctgctgagccgctggaaagcaaccgacctgttcctg
aaagatattcaggttctggtttccgagctgtcgatggtcgatgccacgccggaactgtta
gcgatggtcggtgaagaaggcgcttcggagccttaccgctatctgatgaaaaacctgcgc
tcgcgcctgatggcaacccaggcctggctggaagcgcgtctgaaaggcgagaagctgccg
aaaccggcaggtctgctgacacaaaacgaacagctatgggaaccgctgtacgcctgctac
cggtcgttacaagcttgcggcatgggcattatcgccaacggtgaactgctcgacaccctg
cgtcgtgtgaaatgttttggcgtcccgctggtgcgtattgatatccgccaggaaagcacc
cgccacaccgaagcgctgggtgaactgacccgctacctcggcattggtgattacgaaagc
tggtcagaagcggacaaacaggccttcctgatccgtgagctgaactccaaacgcccgctg
ctaccgcgcaactgggagccgagtaatgacactcgtgaagtgctcgacacctgtaaagtc
atcgccgaagcgccgaaagggtcgattgctgcctacgtcatctcaatggcaaaaacgcca
tctgacgtgctggctgtgcatctactattgaaagaagccggaattggctttgccatgccg
gtggccccgctgttcgagacccttgacgacctgaacaatgccgacgacgtcatgacccaa
ctgctgaacatcgactggtatcgcggtctgattcagggcaagcagatggtgatgattggt
tattccgactcggcaaaagatgccggcgtaatggccgcctcctgggcgcaatatcaggcg
caggatgcgttgatcaaaacttgcgagaaagccggtatcgaactgacgctgttccatggt
cgcggtggttctatcggtcgcgggggcgcaccggcccatgccgccctgctttcacaacca
ccgggcagcctgaaaggcggtctgcgcgtgaccgaacagggcgagatgatccgtttcaaa
tacggtctgccggaagtcaccgtcagcagcctgtcgctatacaccagcgccattctggaa
gcgaacctgctgccgccgccagagccgaaagacgcctggcgtcatatcatggacgaactt
tcagtcatctcctgtgacgtgtaccgtggctacgtgcgtgaaaacaaagactttgtcccg
tacttccgctccgcaacgccggaacaggaactgggcaaactgccgctcggttcgcgtcca
gcgaaacgtcgcccgaccggtggtgtggaatctctgcgcgctattccgtggattttcgcc
tggacgcagaaccgcctgatgttgccagcctggctcggtgccggcaccgcgctgcaaaaa
gtggtggaagatggtaagcagagcgaactggaagcgatgtgccgcgactggccgttcttc
tccacccgtctcggcatgctggaaatggtgttctcaaaagcggatctgtggctggcagaa
tactacgatcagcgcctggtcgcgaaagcgctgtggccgctgggcaaggagctgcgcgaa
ctgctggaagaagacatcaaagtggtgctggcgattgccaacgattcacatctgatggcc
gatctcccgtggattgccgagtctatccagttacggaatatttacaccgacccgctgaac
gttctgcaggccgagctgttacaccgctcacgactgacggaacaacagggcaaagagccc
gatcctcgcgttgaacaagcgctgatggtcaccattgccggcgtggcggcaggtatgcgt
aataccggctaa

DBGET integrated database retrieval system