KEGG   Citrobacter amalonaticus FDAARGOS_165: AL524_06760Help
Entry
AL524_06760       CDS       T04738                                 

Definition
(GenBank) galactonate oxidoreductase
  KO
K23007  L-galactonate 5-dehydrogenase [EC:1.1.1.414]
Organism
caf  Citrobacter amalonaticus FDAARGOS_165
Pathway
caf00053  Ascorbate and aldarate metabolism
caf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:caf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    AL524_06760
Enzymes [BR:caf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.414  L-galactonate 5-dehydrogenase
     AL524_06760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C 3HCDH_N Sacchrp_dh_NADP 2-Hacid_dh_C Pyr_redox_2 Pyr_redox_3 TrkA_N Pyr_redox AdoHcyase_NAD FAD_binding_3 HI0933_like Shikimate_DH UDPG_MGDP_dh_N GIDA NAD_binding_7 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AMG52810
UniProt: A0A381GD95
LinkDB All DBs
Position
1385529..1386551
Genome map
AA seq 340 aa AA seqDB search
MSTMNMLICQEPKKLIHEKREIPIPDKQEALIKIKSVGICGTDIHAWGGNQPFFSYPRVL
GHEICGDIVTLGEKVTQFKVGQQVAVIPYVACQQCPACLGGRTNCCEKISVIGVHQDGGF
SEYLSVPATNLLLAEGIDPQAAALIEPYAISAHAVRRAAIAPGEQVLVVGAGPIGIGAAA
IAKAEGAQVVVADTSAARREHVASRLDLPVVDPSAADFEAQLRALFGGSLAQKVLDATGN
PHAMNNSVNLIRHGGTIVFVGLFKGDLQFSDPEFHKKETTMMGSRNATPEDFAKVGRLMA
EGKLSAEMMLTHRYPFSQLAEIFEQDVINNRTLIKGVITF
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtccacaatgaatatgttgatttgccaggaacccaaaaaattaattcatgagaaacgc
gaaattccaattccggataaacaggaagcgctaattaaaattaagtctgtcggtatttgc
ggaaccgatattcatgcctggggaggtaatcaacctttttttagttatccgcgcgtgcta
ggccatgaaatatgtggggatattgtgacgctcggcgagaaggtgacgcagtttaaagtg
ggtcaacaggtagcggtgatcccgtatgtcgcctgtcagcagtgtccggcgtgcctggga
ggacgaacgaactgctgcgagaagatctcggtgatcggcgtgcatcaggacggggggttt
agcgagtatctcagcgtgccggcgaccaatctgctgttggcggaggggattgatcctcag
gctgcggcgttgatcgagccttacgcgattagcgcgcatgcggtacgccgtgccgctatc
gcccccggtgagcaggtattggtcgttggagccggaccgattgggatcggcgcggcggcc
attgccaaagcagaaggggcgcaggtggtggtggccgataccagcgctgcacgtcgcgaa
cacgttgcttctcgtcttgacctgccggtagtggatccctctgcggcagattttgaggct
caactgcgcgcgctgtttggcggttcactggcgcagaaagtgctcgatgcgacggggaac
ccgcatgccatgaacaatagcgttaacttgatccgccacggcggcaccatcgtttttgtc
gggctgtttaaaggcgacttgcagttctctgacccggaatttcacaagaaagagaccacc
atgatgggcagtcgtaacgccacgccggaggattttgcgaaagtgggacgactgatggca
gaaggcaaactgagcgctgaaatgatgcttacgcatcgctatccgttcagccagcttgcg
gagatcttcgaacaggatgtgattaacaaccggacgttgatcaaaggagtgattacgttc
tga

DBGET integrated database retrieval system