KEGG   Citrobacter amalonaticus FDAARGOS_165: AL524_12885Help
Entry
AL524_12885       CDS       T04738                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
caf  Citrobacter amalonaticus FDAARGOS_165
Pathway
caf00500  Starch and sucrose metabolism
caf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:caf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AL524_12885
Enzymes [BR:caf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AL524_12885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C DUF1939 Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AMG53909
UniProt: A0A381G978
LinkDB All DBs
Position
complement(2649162..2650649)
Genome map
AA seq 495 aa AA seqDB search
MKNPTLLQFFHWYYPEGGKLWQEVTERADSLNDIGINMVWLPPAYKGASGGYSVGYDSYD
LFDLGEFDQKGSLATKYGDKAQLLTAIDALKKNDIAVLLDVVVNHKMGADEKEPLRVQRV
NEDDRTQIADEIIECEAWTRYTFPARGGQYSQFIWDFKCFSGIDHIENPDEDGIFKIVND
YTGEGWNDQVDDEMGNFDYLMGENIDFRNHAVTEEIKYWARWVMEQTQCDGFRLDAVKHI
PAWFYKEWIEHVQEVAPKPLFIVAEYWSHEVDKLQTYIDQVEGKTMLFDAPLQLNFHEAS
RQGRDYDMSQIFSGTLVEADPFHAVTLVANHDTQPLQALEAPVEAWFKPLAYALILLREN
GVPSVFYPDLYGAHYEDTGGDGETYTIDMPVIEQLAELILARQRFAHGIQTLWFDHPNCI
AFSRSGTDDDPGCVVVLSNGDDGEKTLTLGENYGNKTWRDYLGNREEIVITDENGEATFY
CNGGSVSVWVIEEVI
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccccacgttactgcagttcttccactggtattaccctgaaggtggcaaactc
tggcaagaggtgacagagcgcgcagacagcctcaatgatatcggtatcaacatggtctgg
ttaccgcccgcctataaaggcgcgtcaggcggctattccgtcggctatgactcttacgat
ctgtttgatctcggcgagtttgaccaaaaaggttcccttgccaccaaatatggtgataag
gcgcagcttcttacggctatcgacgcgctgaagaaaaacgacatcgcggtgctactcgac
gtggtggtgaatcacaaaatgggggcggacgaaaaagagcccctgcgcgtacagcgggtc
aacgaagacgatcgcacgcagattgccgatgagatcatcgaatgcgaagcctggacgcgt
tacaccttcccggcgcgaggcggtcagtactcgcagttcatctgggatttcaaatgcttc
agcggcatcgaccacatcgaaaaccctgacgaagacggcatttttaaaatcgtcaacgac
tataccggcgagggctggaacgaccaggtcgacgatgaaatgggcaatttcgattacctg
atgggtgaaaatatcgattttcgtaatcacgccgtcactgaggagattaaatactgggcg
cgctgggtgatggaacaaacgcagtgtgatggctttcgtctcgatgcggtaaaacacatt
ccggcctggttctataaagagtggattgaacacgttcaggaggtggcaccgaagccgctg
tttatcgttgccgaatactggtcgcacgaagtggataagctgcaaacctatatcgaccag
gtggaaggcaaaacgatgctgttcgacgccccgttacagctcaattttcatgaagcgtcg
cgtcagggacgtgattacgacatgagccagatcttcagcggcacgctggtagaagccgat
ccgtttcacgccgtgacgctggtcgccaaccatgacacccagccgttgcaggcgctggaa
gcccccgttgaagcatggttcaaaccgctggcctacgcgctcatcctgctgcgggaaaat
ggcgtaccgtcggttttctatcccgatctctacggcgcgcactatgaagataccggaggc
gacggggaaacctataccatcgacatgcctgtcatcgagcaactcgccgaactcattctt
gcccgccagcgtttcgcccacggcattcagacgctttggtttgatcaccccaactgcatt
gctttcagccgtagcggaacggacgacgatcccggatgtgtggtggtgttatccaatggc
gacgacggtgaaaaaacgcttacgctgggtgaaaactacggcaataaaacctggcgcgac
tatctgggaaaccgcgaggagatcgtcatcactgacgaaaatggcgaggctacgttttac
tgcaatggcggcagcgtcagcgtatgggtcattgaggaggtgatctga

DBGET integrated database retrieval system