KEGG   Citrobacter amalonaticus FDAARGOS_165: AL524_18840Help
Entry
AL524_18840       CDS       T04738                                 

Definition
(GenBank) 2,3-diphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
caf  Citrobacter amalonaticus FDAARGOS_165
Pathway
caf00010  Glycolysis / Gluconeogenesis
caf00260  Glycine, serine and threonine metabolism
caf00680  Methane metabolism
caf01100  Metabolic pathways
caf01110  Biosynthesis of secondary metabolites
caf01120  Microbial metabolism in diverse environments
caf01130  Biosynthesis of antibiotics
caf01200  Carbon metabolism
caf01230  Biosynthesis of amino acids
Module
caf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
caf_M00002  Glycolysis, core module involving three-carbon compounds
caf_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:caf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AL524_18840
  Energy metabolism
   00680 Methane metabolism
    AL524_18840
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AL524_18840
Enzymes [BR:caf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     AL524_18840
Membrane trafficking [BR:caf04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    AL524_18840
Exosome [BR:caf04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   AL524_18840
  Exosomal proteins of melanoma cells
   AL524_18840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AMG54993
UniProt: A0A083YXT5
LinkDB All DBs
Position
3910768..3911520
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGVGEAKAAGKLLKAEGYSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLTEKELPLTESLALTIDRVIPYWNETILPRMKSGERVI
IAAHGNSLRALVKYLDNLSEDEILELNIPTGVPLVYEFDENYQPIKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggtacgccacggcgaaagccagtggaacaatgaaaac
cgcttcaccggttggtatgacgttgacctgtccgagaaaggcgtgggtgaagcgaaagca
gcaggcaaactgctgaaggctgaaggctatagcttcgattttgcttatacctctgtgctg
aaacgtgccatccacacgctgtggaacgtcctggatgaactggatcaggcctggctgccg
gttgagaaatcctggaaactgaacgaacgtcactacggtgcgttgcaaggtctgaacaaa
gcagaaaccgctgagaaatacggtgacgaacaggttaaacagtggcgtcgtggtttcgcg
gtgaccccgccggagctgaccaaagatgacgagcgctatccgggccacgatccgcgctat
gccaaactgacggaaaaagaattgccgctgaccgagagcctggcgctgaccatcgatcgc
gtgatcccttactggaatgaaaccattctgccgcgcatgaagagcggcgagcgcgtgatc
atcgctgcgcacggcaactctctgcgcgcgctggtgaaatacctcgacaacctgagcgaa
gacgaaatcctcgaactgaacatcccgaccggcgtgccgctggtgtatgagttcgacgaa
aactaccagccaatcaaacgttactatctgggtaatgccgacgagatcgcggcgaaagcg
gctgccgtcgccaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system