KEGG   Citrobacter amalonaticus FDAARGOS_165: AL524_21080Help
Entry
AL524_21080       CDS       T04738                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
caf  Citrobacter amalonaticus FDAARGOS_165
Pathway
caf00473  D-Alanine metabolism
caf00550  Peptidoglycan biosynthesis
caf01100  Metabolic pathways
caf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:caf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AL524_21080
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AL524_21080
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    AL524_21080
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:caf01011]
    AL524_21080
Enzymes [BR:caf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AL524_21080
Peptidoglycan biosynthesis and degradation proteins [BR:caf01011]
 Precursor biosynthesis
  Amino acid ligase
   AL524_21080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST ATP-grasp_3 ATP-grasp_4 RimK NHase_alpha PTS_2-RNA GARS_A
Motif
Other DBs
NCBI-ProteinID: AMG55376
UniProt: A0A381G2Y0
LinkDB All DBs
Position
4371242..4372336
Genome map
AA seq 364 aa AA seqDB search
MAKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKTRFEVVLLGIDKQGQWHVSDASNYLLN
ANDPAHIALRPSATSLAQVPGRHEQQLIDAQNGQPLPTVDVIFPIVHGTLGEDGSLQGML
RVANLPFVGSDVLGSAACMDKDVTKRLLRDAGLTIAPFITLTRANRNTISFAEVEARLGL
PLFVKPANQGSSVGVSKVTSEAQYAQAVALAFEFDHKVVVEQGIKGREIECAVLGNDHPQ
ASTCGEIVLNSDFYAYDTKYIDDNGAKVVVPAAIDPHINDKIREIAIQAYQALGCAGMAR
VDVFLTADNEVVINEINTLPGFTNISMYPKLWQASGLGYTDLITRLIELALERHAADNAL
KTTM
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagttgcgggtaggaatcgtatttggtggtaaatcagcggaacatgaagtgtca
ttgcaatcggcaaaaaatattgtcgatgccatcgacaagacccgctttgaagtcgtgctg
ttaggcattgataagcaaggacaatggcacgtcagcgatgccagcaattatctgctcaat
gccaacgatcctgcgcatattgcgctgcgtccttctgcgaccagccttgcgcaggttccg
ggcagacacgagcaacagttgattgatgcgcagaatggtcagccgctaccgaccgtagac
gtgattttcccgattgttcacggcacgctgggtgaagatggttcgctgcagggaatgctg
cgcgtggcgaatctgcccttcgtgggttccgacgtgttgggttcagccgcgtgtatggat
aaagacgtcaccaaacgcttgttgcgtgatgccggactgactatcgcgccgtttattacg
ctgacgcgagccaaccgcaacacgataagctttgccgaggtagaagcccgtcttggcctg
ccgctgttcgttaagcccgccaatcagggatcgtctgtcggcgttagcaaagtcaccagc
gaagcgcagtacgcgcaggcggtcgccctcgccttcgaattcgatcacaaagtggtggtg
gagcaagggatcaaggggcgcgagatcgagtgcgcagtgctgggcaacgatcatccgcag
gccagcacctgtggcgagatcgtgctcaacagtgatttctatgcctacgacaccaaatac
attgacgataacggcgcgaaagtggtggttcctgcggcgattgatccgcacatcaacgac
aaaatccgcgagatcgccattcaggcgtatcaggcactgggctgcgctggcatggcacgc
gtcgatgtctttttaaccgccgacaatgaggtggtgatcaatgagatcaacaccctgcca
ggctttaccaacatcagcatgtatccgaaactctggcaggccagtggattaggttacacc
gacttgatcacccgtttgatcgaactggcgctggaacgccatgctgcagataacgcgctg
aaaacgacgatgtaa

DBGET integrated database retrieval system