KEGG   Chloroflexus aggregans: Cagg_1702Help
Entry
Cagg_1702         CDS       T00824                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
cag  Chloroflexus aggregans
Pathway
cag00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:cag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Cagg_1702
Enzymes [BR:cag01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Cagg_1702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh YCII
Motif
Other DBs
NCBI-ProteinID: ACL24603
UniProt: B8GAL4
LinkDB All DBs
Position
2078152..2079648
Genome map
AA seq 498 aa AA seqDB search
MTATRIFHNLIGGEFVPAQSGKTFERRNPADTRDLVGVFADSDERDVHAAVEAAKAAFAT
WSKVPAPKRGEILLRAAELLQARKEQYSRDLTREMGKPLFEAGGDIVEAIGMAQYAGSEG
RRMHGVTTPSELPDKFQMSIRQPIGVVGLITPWNFPMAIASWKMLPAIVCGNTVVIKPGE
DASVSTYNLVQCLMEAGLPPGVVNIVTGYGPKAGQPLVEHPDVPVISFTGSTETGRLVYE
LGARRIKRVSLEMGGKNPLIVMPDADLDLALDGVLWAAFGTTGQRCTATSRLIVHRAVAK
ELVDRIVARAQSLRIGNGLDPNTDMGPLVNEKQMQRVLNYIEIGKQEGATLLCGGYRLTG
GDYDYGYFIAPTVFTNVTPQMRIAREEIFGPVLSVIEVDSLDEAVAIANDVAYGLSSAIY
TRDINAAFRAMQALQAGIVYINAPTIGAEIHLPFGGVKATGNGHREAGPTMLDVFSEWKS
VYIDYSGRLQRAQIDNAD
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaacgcggatctttcacaatctgatcggcggcgagtttgtaccggcccaaagt
ggcaaaaccttcgagcgacgcaatcccgccgacacccgcgatctggtcggtgtattcgcc
gatagtgatgaacgcgatgtccatgccgcggttgaagcggctaaagcagcctttgccaca
tggagcaaagtgcctgcccccaagcgtggtgagattctgctccgcgctgccgagttactt
caagcccgcaaagagcagtatagtcgtgatctcacccgcgagatgggcaaacccctgttt
gaagccggtggcgacatcgttgaggctatcgggatggctcaatatgccggtagcgaagga
cgccgcatgcacggtgtgaccaccccgtcggaattgcccgacaaattccagatgagcatt
cgccagcccatcggcgtagtcgggcttatcaccccctggaacttcccgatggccattgcc
tcgtggaagatgctaccggcgatcgtctgcggcaacacggttgtcatcaaacccggcgaa
gacgcttcggtgagtacctacaacctggtacagtgtctgatggaagccggcctaccgccc
ggcgtcgtcaatatcgtcaccggctatgggccaaaagccggccaacctctcgtcgaacat
cctgacgtaccggtcatctctttcaccggtagcaccgaaaccggccggctcgtgtatgag
ctaggcgcacgccggatcaagcgtgtcagccttgagatgggtggtaaaaacccgttgatt
gtcatgcctgacgccgatctcgatcttgcgctcgacggcgtcttgtgggctgcgtttggc
acgaccggccaacgttgcactgccaccagccgcctgatcgttcaccgtgccgtcgcgaag
gagctggttgaccgaattgttgctcgcgcccaatcgctccgcattgggaatggtctcgat
ccgaataccgatatgggtccgctggtgaacgagaaacagatgcaacgagtgcttaattat
atcgagattggtaagcaagaaggagcaaccttgctctgtggcggttaccgcctcaccggc
ggcgattacgactacggctattttattgcgccgaccgtcttcaccaacgtcacaccccag
atgcgcatcgctcgcgaagaaatctttgggccggtgctgagtgtgattgaggttgatagt
ctcgatgaagcggtggcaattgccaatgatgtggcctatggccttagttcggcaatttat
actcgtgatattaacgctgctttccgcgctatgcaggcgctgcaagccgggattgtttac
atcaacgctcctaccatcggcgctgaaattcacttgccgttcggtggtgtgaaggcgacc
ggtaacggtcatcgcgaagccggcccgacgatgctcgatgtcttctcggagtggaagagc
gtctacattgattacagcggcagattgcagcgcgcacagattgataacgccgattag

DBGET integrated database retrieval system