KEGG   Chloroflexus aggregans: Cagg_2702Help
Entry
Cagg_2702         CDS       T00824                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cag  Chloroflexus aggregans
Pathway
cag00010  Glycolysis / Gluconeogenesis
cag00030  Pentose phosphate pathway
cag00051  Fructose and mannose metabolism
cag00052  Galactose metabolism
cag00680  Methane metabolism
cag01100  Metabolic pathways
cag01110  Biosynthesis of secondary metabolites
cag01120  Microbial metabolism in diverse environments
cag01130  Biosynthesis of antibiotics
cag01200  Carbon metabolism
cag01230  Biosynthesis of amino acids
cag03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:cag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cagg_2702
   00030 Pentose phosphate pathway
    Cagg_2702
   00051 Fructose and mannose metabolism
    Cagg_2702
   00052 Galactose metabolism
    Cagg_2702
  09102 Energy metabolism
   00680 Methane metabolism
    Cagg_2702
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Cagg_2702
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:cag01009]
    Cagg_2702
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:cag03019]
    Cagg_2702
Enzymes [BR:cag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cagg_2702
Protein phosphatases and associated proteins [BR:cag01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Cagg_2702
Messenger RNA biogenesis [BR:cag03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Cagg_2702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ACL25570
UniProt: B8G4U4
LinkDB All DBs
Position
3307833..3310076
Genome map
AA seq 747 aa AA seqDB search
MTNTPIRIGVLTSGGDAPGMNAAVRAVVRTGISHGCEVYAIYEGYKGLIQGGTLIRRMDW
SSVGGIIQRGGTIIGTARSAEFRTREGRRQAAANLVTLGIDRLVIIGGDGSLTGADLFRR
EWPELLAELVAAGTISEAQAAAHPHLRIAGIVGSIDNDFCGTDMTIGADTALHRITEAID
AISSTAASHQRTFVIEVMGRNCGYLALMGAIAGGADWAFIPEMPPQMDDWEQHMCDVLRI
GREHGRRDSIVVVAEGACDRHGKPITAHYVKKVLEERLGEDTRVTILGHVQRGGAPSAFD
RWMSSLLGATAVEELLNADADAEPKLIGLRENRVVRLPLMTCVSDTRQVAEAIAQHDYER
AIAMRGNSFVEAYRTLGTLIQSQPSPPDRLRRGHRFAVMHSGGPAPGMNTAVRAAVRIGI
DRGHTMLGVRNGFQGLIDGDIFEMDWMSVSGWATMGGAELGTNRKIPQGSELYQIARNIE
RFGIDGILMIGGWAGYQAAYKLYSERHIFPAFNIPIICLPATIDNNLPGSELSLGADTAL
NSIVHAVDRIKQSAVASRRCFIVEVMGRDCGYLALMSGLATGAERVYLPEEGINLRTLQS
DLDEMMEWFRRGKRLSLIIRNEKANPIYTTSFICSLFEEEGGKLFEVRQAILGHLQQGGD
PSPFDRIQATRLAVRCIEFLIEHADRQEPVGAFIGYRGGKVQVHPIEDMPRLMDPVHARP
REQWWLALRQMTRLLTTPPVFHQVEQK
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacacacctattcggattggagtattgaccagcggtggcgatgcaccaggcatg
aatgccgcagtacgcgcggtggtccgtaccggaattagtcacggctgcgaagtatacgct
atctacgagggatataagggtctgatccaaggcggcacgttgatccgacgaatggattgg
agttcggtcggtgggattatccagcgcggggggacgatcatcgggacggcgcgcagtgct
gagttccggacgcgagaaggacgacggcaggcagcggcgaatctggtgacactcgggatt
gaccgattggtgattatcggtggtgatggcagcttgaccggggccgatctttttcgtcga
gagtggccggagttgttggccgagttggtagcggcgggtacgattagcgaagcccaagcg
gcggcgcatccgcatttacgcattgccgggattgtggggagcatcgacaatgatttctgt
ggcaccgacatgactattggtgccgataccgctctccaccggattaccgaggcgattgat
gcaattagctcaacggcagccagccatcagcgtacctttgtgatcgaagtcatggggcgc
aattgtggctatctggcgctcatgggagcgattgccggtggcgccgattgggcgtttatc
ccagagatgccaccgcagatggacgactgggagcagcacatgtgtgatgtgttgcggatc
gggcgtgagcatgggcggcgcgatagcattgtagtggtggctgaaggtgcgtgcgatcgt
cacggtaagccgattacagctcactatgtcaagaaggtccttgaggagcgcttaggtgag
gatacgcgcgtgactattctcggccacgtgcaacgtggtggtgcgccgagtgcatttgat
cgctggatgagttcgttgttgggagcaacagccgttgaagagttgctgaacgcggatgcc
gatgctgagccgaagctgatcggtttgcgggaaaatcgggtcgtgcggttgccgctcatg
acgtgcgtgagcgatacgcggcaggtggctgaggccattgctcaacacgattatgagcgg
gctatcgcgatgcgtgggaatagttttgtcgaggcgtatcgtacccttgggaccctcatc
cagtcccagccctcgccccccgaccgcttgcggcgcggtcaccggttcgctgtgatgcac
agtggtggtccggcgccgggaatgaataccgcggtccgggcagcagtacggatcgggatt
gatcgcggtcatacgatgcttggggtgcgtaacggctttcagggcctgatcgatggcgat
atctttgaaatggactggatgagtgtcagtggttgggcgacgatgggcggcgccgaactc
ggtaccaatcgtaagattccccaagggagcgaactgtaccaaatcgcgcgcaatatcgaa
cgattcgggatcgatgggatcttgatgatcggtggttgggccggttatcaggcagcgtac
aaactctacagcgagcggcatatttttccggcgttcaatattcctatcatttgcttgccg
gcaacgattgataacaatctacccggttctgaacttagcttgggggccgatacagcactc
aatagcatcgttcatgcggttgatcggattaagcaatcggcggtggcctcccggcggtgt
tttattgtcgaggtgatggggcgcgattgtgggtatcttgcgctgatgagcggtctcgcc
accggcgccgaacgggtctatctgcctgaagaggggattaacttgcgcacgttgcaatcc
gatctcgatgagatgatggagtggttccgacgtggtaaacggttgagtctgattatccgc
aacgagaaggctaatccgatctatacgacctcgtttatctgctcactgtttgaagaagag
ggcggcaagctgtttgaggtgcggcaggcaattctcggtcatttgcagcagggtggtgat
ccatcaccgtttgatcggattcaggcaacacgcctggccgtccgctgtattgagtttctg
atcgagcatgccgatcggcaggagccggtgggtgcttttatcgggtatcgtggcggtaag
gtgcaggtgcatccaattgaggatatgccgcggctgatggatccggtccatgcgcgtccg
cgtgagcagtggtggttggcgttacgccagatgacgcggttgctaacgacgccgccggtg
tttcatcaagttgagcagaagtga

DBGET integrated database retrieval system