KEGG   Clostridium autoethanogenum: CAETHG_0092Help
Entry
CAETHG_0092       CDS       T02883                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
cah  Clostridium autoethanogenum
Pathway
cah00030  Pentose phosphate pathway
cah01100  Metabolic pathways
cah01120  Microbial metabolism in diverse environments
cah01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CAETHG_0092
Enzymes [BR:cah01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     CAETHG_0092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N DUF2291 DUF2275 HATPase_c_4
Motif
Other DBs
NCBI-ProteinID: AGY74327
UniProt: U5RP02
LinkDB All DBs
Position
87174..88997
Genome map
AA seq 607 aa AA seqDB search
MYGYDGKVLRINLKERTCKSENLDLDKAKKFIGCRGLGVKTLFDEIDPKIDALSPENKFI
IVTGPLTGAPVPTSGRFMVVTKAPLTGTIGISNSGGKWGVDLKKAGWDMIIVEDKADSPV
YIEIVDDKVEIKDASQLWGKVTSETTKELEKITENKSKVLCIGPAGERLSLMAAVMNDVD
RTAARGGVGAVMGSKNLKAITVKGTGKIALADKEKVKKVSVEKITTLKNDPVAGQGMPTY
GTAILVNIINENGVHPVKNFQESYTNQADKISGETLTANQLVRKNPCYSCPIGCGRWVRL
KDGTECGGPEYETLWCFGSDCGSYDLDAINEANMLCNEYGIDTITCGATIAAAMELYQRG
YIKDEEIAGDNLSLKWGDTESMIGWIKRMVYSEGFGAKMTNGSYRLCEGYGAPEYSMTVK
KQEIPAYDPRGIQGHGITYAVNNRGGCHIKGYMINPEILGYPEKLDRFALDGKAAYAKLF
HDLTAVIDSLGLCIFTTFGLGIQDYVDMYNAVVGESTYDADSLLEAGDRIWTLEKLFNLA
AGIDSSQDTLPKRLLEEPIPDGPSKGEVHRLDVLLPEYYSVRGWSKEGIPTEETLKKLGL
DEYIGKF
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgtatggttatgatggtaaagtattaagaattaatttaaaagaaagaacttgcaaatca
gaaaatttagatttagataaagctaaaaagtttataggttgtaggggactaggtgttaaa
actttatttgatgaaatagatcctaaaatagatgcattatcaccagaaaataaatttata
attgtaacaggtcctttaactggagctccggttccaactagtggaaggtttatggtagtt
actaaagcaccgcttacaggaactataggaatttcaaattcgggtggaaaatggggagta
gacttaaaaaaagctggttgggatatgataatagtagaggataaggctgattcaccagtt
tacattgaaatagtagatgataaggtagaaattaaagacgcgtcacagctttggggaaaa
gttacatcagaaactacaaaagagttagaaaagataactgagaataaatcaaaggtatta
tgtataggacctgctggtgaacgattgtctcttatggcagcagttatgaatgatgtagat
agaactgcagcaagaggcggcgttggtgcagttatgggatctaaaaacttaaaagctatt
acagttaaaggaactggaaaaatagctttagctgataaagaaaaagtaaaaaaagtgtcc
gtagaaaaaattacaacattaaaaaatgatccagtagctggtcagggaatgccaacttat
ggtacagctatactggttaatataataaatgaaaatggagttcatcctgtaaagaatttt
caagagtcttatacgaatcaagcagataaaataagtggagagactcttactgctaaccaa
ctagtaaggaaaaatccttgttacagctgtcctataggttgtggaagatgggttagacta
aaagatggcacagagtgcggaggaccagaatatgaaacactgtggtgttttggatctgac
tgtggttcatatgatttagatgctataaatgaagctaatatgttatgtaatgaatatggt
attgatactattacttgtggtgcaacaattgctgcagctatggaactttatcaaagagga
tatataaaagacgaagaaatagctggagataacctatctctcaagtggggtgatacggaa
tctatgattggctggataaagagaatggtatatagtgaaggctttggagcaaagatgaca
aatggttcatataggctttgtgaaggttatggagcaccggagtattctatgacagttaaa
aagcaggaaattccagcatatgatccaaggggaatacagggacacggtattacctatgca
gttaataatagaggaggctgtcatattaagggatacatgattaaccctgaaatattaggt
tatcctgaaaaacttgatagatttgcattagatggtaaagcagcttatgccaaattattt
catgatttaactgctgtaattgattctttaggattgtgcatattcactacatttgggctt
ggaatacaggattatgtagatatgtataatgcagtagtaggagaatctacttatgatgca
gattcactattagaggcaggagatagaatctggactcttgagaaattatttaatcttgca
gctggaatagacagcagccaggatactctaccaaagagattgttagaagaacctattcca
gatggcccatcaaagggagaagttcataggctagatgttcttctgccagaatattactca
gtacgaggatggagtaaagagggtatacctacagaagaaacattaaagaaattaggatta
gatgaatatataggtaagttctag

DBGET integrated database retrieval system