KEGG   Clostridium autoethanogenum: CAETHG_0344Help
Entry
CAETHG_0344       CDS       T02883                                 

Definition
(GenBank) Putative Succinate dehydogenase/fumarate reductase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
cah  Clostridium autoethanogenum
Pathway
cah00020  Citrate cycle (TCA cycle)
cah00190  Oxidative phosphorylation
cah00650  Butanoate metabolism
cah01100  Metabolic pathways
cah01110  Biosynthesis of secondary metabolites
cah01120  Microbial metabolism in diverse environments
cah01130  Biosynthesis of antibiotics
cah01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CAETHG_0344
   00650 Butanoate metabolism
    CAETHG_0344
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CAETHG_0344
Enzymes [BR:cah01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CAETHG_0344
    1.3.5.4  fumarate reductase (quinol)
     CAETHG_0344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 DHODB_Fe-S_bind Fer2
Motif
Other DBs
NCBI-ProteinID: AGY74575
UniProt: U5RPB8
LinkDB All DBs
Position
complement(367490..367816)
Genome map
AA seq 108 aa AA seqDB search
MKVKVYRFEPTVEEGEHYDCFDVPVIFEEKWTVMNVLDYIQEHCDSSLSYYKHSACGHGI
CGRCTLMVDGTPSLACTHVIEKGDEIVLEPLKGRKKVKDLVTISMNLT
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaaaagtatatcgatttgaaccaacagtagaagaaggtgaacattatgactgt
tttgatgttccagtaatttttgaagaaaagtggactgtaatgaatgttctcgattatatc
caggaacattgtgacagcagtttgagctattacaaacacagtgcctgtggccatggaatt
tgtggaagatgcactcttatggttgatggtactccttctcttgcatgcacacatgtaata
gagaagggcgatgaaattgtccttgagcctttaaaaggaagaaaaaaagtaaaagatttg
gttactatatcaatgaatcttacttag

DBGET integrated database retrieval system