KEGG   Clostridium autoethanogenum: CAETHG_0385Help
Entry
CAETHG_0385       CDS       T02883                                 

Definition
(GenBank) (R,R)-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
cah  Clostridium autoethanogenum
Pathway
cah00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:cah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CAETHG_0385
Enzymes [BR:cah01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     CAETHG_0385
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     CAETHG_0385
    1.1.1.-  
     CAETHG_0385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc 2-Hacid_dh_C Shikimate_DH ADH_zinc_N_2 AlaDh_PNT_C TrkA_N ApbA NAD_binding_7 FAD_binding_3 AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: AGY74614
UniProt: U5RSS2
LinkDB All DBs
Position
complement(413109..414182)
Genome map
AA seq 357 aa AA seqDB search
MKAVLWYDKKDVRVEEIEEPKVKENAVKIKVKWCGICGSDLHEYLGGPIFIPVGTPHPLS
KSTAPVVLGHEFSGEVVEIGSKVTKFKAGDRVIVEPIVACGKCPACLEGKYNLCEALGFH
GLCGSGGGFAEYTVFPEDFVHKIPDTMDYEQAALVEPMAVALHSLRVGNFTTGNTALVLG
AGPIGLATIQCLKASGARIVIVFQRKSVRQEYAKKFGADVVLDPNEVDVIEEIKKLTGGV
GVDTSFETTGANVGINTAIQALKYEGTAVITSVWEKNAEINPNDLVFTEKKVVGTLAYRH
EFPSTIALMNDGRIKTDGYITKRIALEDIVKEGFETLTGPEKKKHVKIIVTPDKSLL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgtattgtggtatgataaaaaagatgtaagagtagaggaaattgaggaacct
aaggtaaaagaaaatgctgtaaaaattaaagtgaaatggtgtggtatatgtggttctgac
ttgcatgagtatttaggaggacctatatttattccagtaggtacgccacatcctttaagc
aagagtactgcaccagtagttttaggacatgagttttcaggagaagtagtagaaatagga
agcaaggttacaaaatttaaagcaggagatagagttattgtagaacctatagttgcctgt
ggaaagtgtcctgcttgtcttgaaggaaaatataatttatgtgaagctttgggatttcat
ggactttgtggaagcggcggcggatttgctgaatacacagtatttcctgaagattttgtc
cataagataccagatactatggactatgagcaggctgcacttgttgagcctatggcagtt
gcccttcattctctaagagttggaaactttactacaggaaatactgctttggttttaggt
gcaggacctataggacttgcaactattcagtgtttaaaggcatcaggggcaagaattgta
attgtatttcagagaaaatctgtaagacaggaatatgctaagaaatttggagcagatgta
gttttagatccaaatgaggtagatgtaattgaagaaattaaaaaacttacaggcggcgta
ggcgtggatacatcttttgaaacaacaggtgcaaatgtagggattaatacggcaattcaa
gctttaaaatatgaaggtactgcggtaataaccagcgtatgggagaaaaatgcagaaatc
aatccaaatgatcttgtatttacagaaaagaaggtagttggtactcttgcctacagacat
gaatttccttctacaatagcacttatgaatgatggaagaataaagacagacggatatatt
acaaagagaatagcacttgaggacattgtaaaagaaggatttgaaacacttacaggacct
gaaaagaaaaaacatgtaaaaataattgtaactcctgacaaatccttattgtaa

DBGET integrated database retrieval system