KEGG   Clostridium autoethanogenum: CAETHG_0977Help
Entry
CAETHG_0977       CDS       T02883                                 

Definition
(GenBank) superoxide dismutase copper/zinc binding protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cah  Clostridium autoethanogenum
Brite
Enzymes [BR:cah01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CAETHG_0977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AGY75202
UniProt: U5RRJ0
LinkDB All DBs
Position
complement(1046257..1046784)
Genome map
AA seq 175 aa AA seqDB search
MHFDEYECPFISGYRGDMNMHTRKAIAHITGGPLAPNIRGTVTFTQVRGGTEVSVEVNGL
PPYRPAMNGNPQIGPHGFHIHQNGTCAVGNPEEPFKAAGGHWNPTNQPHGNHAGDFPVLF
SNNGYCRMTFFTNKFNVAQIIGKSVIIHESPDDYRTQPSGASGKMLACGVIKAMM
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgcattttgacgaatatgaatgtccctttataagtggatataggggcgatatgaatatg
catactagaaaagctatagctcatataactggaggacctttagctcctaatataagaggt
actgtaacttttactcaggtacgtggaggaactgaggtttctgtagaagtaaatggatta
cctccttatagacctgctatgaatggaaatccacaaattggaccccatggatttcatata
caccaaaatggtacatgtgctgtaggtaatcctgaagagccatttaaagctgcaggagga
cattggaatccaaccaatcagccacatggcaatcatgcaggagattttccagttcttttt
tcaaataatggttattgtagaatgaccttctttacaaataagtttaatgttgctcagatt
ataggaaaatcggtaatcatacatgaaagcccagatgattatagaactcagccttccgga
gcatctggtaaaatgctagcttgtggtgttattaaggcaatgatgtaa

DBGET integrated database retrieval system