KEGG   Clostridium autoethanogenum: CAETHG_1140Help
Entry
CAETHG_1140       CDS       T02883                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cah  Clostridium autoethanogenum
Pathway
cah00473  D-Alanine metabolism
cah01100  Metabolic pathways
cah01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cah00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CAETHG_1140
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CAETHG_1140
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cah01011]
    CAETHG_1140
Enzymes [BR:cah01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CAETHG_1140
Peptidoglycan biosynthesis and degradation proteins [BR:cah01011]
 Precursor biosynthesis
  Racemase
   CAETHG_1140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AGY75365
UniProt: U5RRP1
LinkDB All DBs
Position
1228319..1229485
Genome map
AA seq 388 aa AA seqDB search
MFKDYRPVWEEINLDNLVYNIRQIKLKVGNNKGLIGVVKANAYGHGALEVSQVLLENGVN
RLAVSELDEAIELRENGIKAPIMILGIVPDTFLNDIIDYNVEPVVPSYEYASKLSKVAKN
KWKTAKIHVAVDTGMGRIGFQPNENSIEEIYNISKLPNIEIQSLFSHFSTSDEKDKTYSQ
EQFEKYKTFYNELINRKIKISMRDIANSAAIMELQDTYCDAVRPGIIIYGYYPSDDVDRN
DLSIKPVMSLKAKVAYVKTLEAGKYVGYGRKFKSERKSVIATLPIGYADGYTRMLSGKAK
VIVNGKFAPVVGNICMDQCMIDVTDAGEVNVGDEVILMGEKNGLKFDAEDIAKTIGTISY
EILCSISRRVPRVYIKDGKIIKIRNYLK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
ttgtttaaagattacagacctgtatgggaagaaattaatttagacaatcttgtatataat
atacgtcaaataaagctgaaagttggtaataataaaggactgataggtgttgttaaagct
aatgcctatggccatggagctttagaagtatcacaagttttattagaaaatggagtaaat
agattggccgtatctgagttagatgaagcaatagaacttagagaaaatggaattaaagct
cccataatgatacttggcatagtcccagatacttttttgaatgacataatagattataat
gtagagccagtggtgccttcttatgaatatgcaagtaaattatcaaaagtagctaaaaat
aaatggaaaactgcaaaaatacacgttgcagtagatactggaatgggaagaataggattc
cagccaaatgaaaatagcatagaagaaatatacaacataagcaaacttccaaatatagaa
atacaaagcttattttctcatttttccacttcagatgaaaaagacaaaacatattcacag
gaacaatttgaaaagtacaaaacattttacaatgagctcataaatagaaagataaaaata
agcatgagagatattgcaaatagtgcagctataatggaattacaagacacttattgtgat
gcagttagaccaggaataataatttatggatattacccttcagatgacgtagatagaaat
gatctaagcataaaacctgtaatgagtttaaaagctaaagtagcttatgtaaagacatta
gaagctggaaaatacgttggctatggaaggaagttcaaatctgaaagaaaaagtgtaata
gctacacttccaataggatatgcagatggctatactagaatgctttcaggaaaggcaaaa
gtaatagtcaatggtaaatttgcaccagtagttggtaacatctgtatggatcagtgcatg
atagatgttacagatgcaggtgaagtaaatgtaggcgatgaagtaatactcatgggtgaa
aaaaacggattgaaatttgatgcggaagatatagctaaaacaattggaactataagttat
gaaatactctgctccataagtagaagagttccaagggtatatataaaagacggaaaaata
atcaaaattagaaattacctgaaataa

DBGET integrated database retrieval system