KEGG   Clostridium autoethanogenum: CAETHG_3344Help
Entry
CAETHG_3344       CDS       T02883                                 

Definition
(GenBank) serine/threonine protein kinase with PASTA sensor(s)
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cah  Clostridium autoethanogenum
Brite
KEGG Orthology (KO) [BR:cah00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cah01001]
    CAETHG_3344
Enzymes [BR:cah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CAETHG_3344
Protein kinases [BR:cah01001]
 Serine/threonine kinases: Other
  Bacterial family
   CAETHG_3344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kinase-like APH RIO1 Pkinase_fungal PBP1_TM Kdo Haspin_kinase FTA2
Motif
Other DBs
NCBI-ProteinID: AGY77547
UniProt: U5RYA0
LinkDB All DBs
Position
3598237..3600144
Genome map
AA seq 635 aa AA seqDB search
MIGTMLGNRYELLEKIGEGGMAIVYRAKDHLLSRNVAVKILKEEFSSDGEFVEKFKREAA
AAASLSDNNIVNIYDVGTQKDINYIVMECVIGKTLKQVIKEEKKIPPARAVEVAIQIAKA
LKCAHKNNIIHRDIKPHNILVTEDGIVKVTDFGIAKASDSVTITNSNKIMGSAHYFSPEQ
AKGSFVDFRTDIYSLGIVMYEMVTGRVPYDAESPVSIALKHIQEPVVPPNQLNENIPDSL
NRLILKAVEKEPIRRYQTMEDMLVDLKKIENNQKINLSDDDLSGDMTRIMDPVDVNNAYK
NEDDYDDEVEPARKPVKLNLDPKKKKRILTTAIGVLVVVIGIISGYIWYNKVYSSGDITV
PSIVGMKQDDAKQLVESKKLNFVIGGKEKSDKPEGTVIDCFPKSGTKVKSNSDVRVIISS
GSDSLTVPNLVGVDFATAKDIISNSGLTLGNVSYRHSDDVAEGDVISQDPTADSKAQNGT
KVNLVVSKGADAKYVTVPDVSGKNIEEAASIMAGSGLKVSRNPVATSDKSQSGVVTSQSI
GGSQQVKEGTTVSLTYYEYKETQNDQSSNLGTPTGGKSTGSSGQSKDGSDTGSGSGSSGS
KSDNGSGTGSSSSDGGTGNNGNTNTGGTGNSDKTN
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgatagggactatgctagggaatagatatgagttgcttgaaaaaataggagagggaggt
atggctattgtttatagggccaaagaccacctcttgagcagaaacgtagctgttaaaatt
ctcaaagaagaattttcaagtgatggagaatttgtagagaaatttaaaagggaagcagca
gcagcagcaagtctttcagataataatatagtgaacatatatgatgtaggtacacagaag
gatataaactacatagtaatggaatgtgttattggaaagactttaaaacaagtaataaaa
gaagaaaagaaaatacctcctgcaagggcagtagaagtagctattcaaatagctaaagct
ttgaaatgtgcccataagaataatattatacatagagatataaaacctcataatattctt
gtgacagaagatggtatagtaaaagtaacggactttggtatagccaaagcctcggattca
gttacaataactaattctaataagataatgggttctgcacactacttttccccagaacaa
gcaaaaggaagctttgtagactttagaacagatatttactcccttggcatagttatgtat
gaaatggttacaggacgtgttccctatgatgcagaaagtcctgtatcaatagcactaaaa
catatacaagaacctgtagttccaccaaatcagttaaatgaaaatataccagatagttta
aatagacttattctgaaagctgtggaaaaagagcctataagaagatatcagacaatggaa
gatatgttagtggatttgaaaaagatagaaaataatcaaaaaatcaatttgtcagatgat
gacttaagtggtgatatgactaggataatggatcctgtagatgtaaacaatgcttataaa
aatgaggacgattatgatgatgaagtagagccagcaagaaaaccagttaaattaaactta
gaccctaaaaagaaaaagagaatattgaccaccgcaataggtgttcttgtagttgtaata
ggtataatttcaggatatatttggtataacaaggtatatagcagcggagacataactgtg
ccgagtattgtaggcatgaaacaggatgatgccaaacagttagtagaaagcaaaaagctt
aattttgtaataggtggcaaagaaaaaagtgacaaaccagaaggaacagtaatagattgt
tttcctaaatcaggaacaaaggtaaaatcaaactcagatgtaagggtaattataagcagt
ggatctgattcactgactgttccaaatttggttggggtagattttgctactgcaaaggat
attatatcaaacagtgggctcactttgggaaatgtatcttacagacacagtgacgatgta
gcagaaggagatgttataagccaagatcctacagcagatagtaaagctcaaaatggtaca
aaagtaaatcttgtggtaagtaagggagcagatgcaaaatatgtaacagtaccagatgtt
tcaggcaaaaacatagaagaagcagcttctataatggcaggttcaggacttaaggtttct
agaaatccagtagctacttcagataaatctcagagtggagttgtaacaagccaaagcata
ggaggatcacagcaagttaaagaaggtactacggtaagcttaacttattatgaatataaa
gaaactcaaaatgatcaaagtagtaatttaggaaccccaactggaggaaaaagcactgga
agcagcggacaaagtaaggatggaagcgatacaggaagtggaagcgggtctagcggaagt
aaatctgataatggaagcggcacaggcagttcttcttctgatggaggtacaggaaacaat
ggaaatacaaatacgggtggtacaggaaattcagataaaacaaattag

DBGET integrated database retrieval system