KEGG   Clostridium autoethanogenum: CAETHG_3915Help
Entry
CAETHG_3915       CDS       T02883                                 

Definition
(GenBank) TrkA-C domain protein
Organism
cah  Clostridium autoethanogenum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrkA_C GntR HTH_11 HTH_DeoR HTH_Crp_2 Castor_Poll_mid HTH_28
Motif
Other DBs
NCBI-ProteinID: AGY78116
UniProt: U5RZ94
LinkDB All DBs
Position
4195623..4196255
Genome map
AA seq 210 aa AA seqDB search
MSSQNVTKPVYQKIAIDIANRILDGDFSIGDKLHGRSSLSSHYNVSPETVRRAIMLLNEV
DIVEVIKGSGIIVKSVDNCLKFINKFKDIGSMNKSKNQILGLLNERNEIEKKIGERINEL
LDYSNRFVNINPFMPFEFKIYKGLSIVGKTICESKFWQNTNATIIGIRREGNLILSPGPY
AVFKEEDIFLAIGEEDVYHKIKKFLYGDNN
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcgcaaaatgttacaaaacctgtataccagaagatagcaattgatatagctaat
agaatattagacggtgatttttccataggggataaacttcatggaagatcatctctttca
agtcattataatgtttctcctgaaactgtaagaagagctattatgcttttaaatgaagtg
gatattgtagaagtgataaagggcagtgggattattgttaaatccgtggataattgtttg
aaatttataaataaatttaaggacataggttccatgaataaatctaaaaatcaaattttg
ggcttattaaatgagagaaatgaaattgaaaaaaaaattggagaaagaataaatgaactc
ctagattactcaaatagatttgtaaacattaatccattcatgccttttgaatttaaaata
tataagggactcagcattgtagggaaaactatatgtgagagtaagttctggcaaaataca
aatgctactataataggtatacgtagagaaggaaatttaatactttctccaggaccttat
gctgtatttaaagaggaagatatttttttagcaataggcgaagaagatgtgtaccataaa
atcaaaaaatttctttatggagataataattag

DBGET integrated database retrieval system