KEGG   Catenulispora acidiphila: Caci_1014Help
Entry
Caci_1014         CDS       T00967                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cai  Catenulispora acidiphila
Pathway
cai00564  Glycerophospholipid metabolism
cai01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cai00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Caci_1014
Enzymes [BR:cai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Caci_1014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 GIDA Trp_halogenase 3HCDH_N Pyr_redox NAD_binding_8 HI0933_like
Motif
Other DBs
NCBI-ProteinID: ACU69942
UniProt: C7Q482
LinkDB All DBs
Position
1153655..1155313
Genome map
AA seq 552 aa AA seqDB search
MAERELDVVVVGGGVVGTGTALDAATRGLSVGLLEARDWASGTSSRSSKLIHGGLRYLEM
LDFGLVREALKERGLLLERLAPHLVRPVPFLYPLTGRGWERLYAGSGVALYDGMATSSSH
GRGLPLHRQLTRRAALRIAPALKRSSLVGAIQYYDAQVDDARYVTFLARTAASYGAHVAS
RARVTGFLREGERVTGVIAKDLETGKSIEIRAKQVVNATGVWTDETQALVGERGRFHVRS
SKGIHLVVPKDRIHSSSGIILRTEKSVLFVIPWDRHWIIGTTDTDWTLDKAHPAASQTDI
QYLLDHVNAVLNVPLSRADVEGVYAGLRPLLAGESDETSQLSREHIVAHVVPGLVVVAGG
KYTTYRVMAQDAVDAAVHGLGGGVPASITENVPLLGADGFQAVWNNRGRIAARSGLHVAR
VEHLLHRYGSLIDEVLDLMTEQPELAEPLPGAEDYLKAEVVYAAAAEGALHLDDVLARRL
RVSIETFDRGVGAAEPTARLIAPVLGWTEEQIAREVEHYVARVAAERESQEQPDDATADA
ARLGAPDIVPVK
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcgcgagctcgacgtcgtggtcgtgggcggcggggtcgtgggaaccgggacg
gcgttggacgccgcgacccggggtttgagcgtgggtctgctggaggcgcgggactgggcg
tcggggacgtcctcccgctcctccaaactcatccacggcggtctccgctatctggagatg
ctcgacttcggtttggtccgcgaggcgttgaaggagcgcgggctgctgttggagcggctg
gctccgcacctggtgcgtccggtgccgttcctctatcccctgacaggtcgtggctgggaa
cgcctctacgcgggttccggtgtggcgctgtacgacggcatggccacgtcgtcgagccac
ggcagaggtctgcctctgcaccggcagctgacgcgccgcgctgcgttgcgtatcgcgccc
gcgcttaagcgttcctcgcttgtgggggcgatccagtactacgacgcgcaggtggacgac
gcgcggtacgtcaccttcctggcgcgcaccgcggcgagctacggcgcgcatgtggcgtct
cgggcccgcgtcaccggcttcctgcgcgagggggagcgcgtcaccggcgttatcgccaag
gacttggagaccggtaagtcgatcgagatccgcgccaagcaggtcgtgaacgcgactggc
gtgtggaccgacgagacgcaggcgttggtgggggagcgcggacgcttccatgtgcgctcc
tctaagggaatccacttggtggttcccaaggaccgtattcactcctcgagcggaatcatc
ctgcgcacggagaagtccgtgctgttcgtcatcccgtgggaccggcactggatcatcggg
accaccgacaccgactggacgctcgacaaggcgcacccggcggcgtcgcagaccgacatc
cagtacctgctggaccacgtgaacgcggtgctgaacgtgccgctgtcgcgcgcggacgtc
gagggcgtatacgccggactccgtccgctgctggccggcgagtcggacgagacctcgcag
ctgtcgcgggagcacatcgtcgcgcacgtcgtccccggcctggtcgtcgtcgccggcggc
aagtacacgacctaccgcgtgatggcgcaggacgccgtggacgcggccgtccacggtctg
ggaggcggagtgcccgcctcgatcaccgagaacgtgccgctgctcggcgcggacggtttc
caggcggtgtggaacaaccgcggacgcatcgccgcgcgcagcggactgcacgtcgcgcgc
gtggagcacctgctgcaccgctacggctcgctgatcgacgaggtcctggacctgatgacc
gagcagccggaactggccgagccgctgcccggcgccgaggactatctgaaggcggaggtc
gtctacgcggcagcggccgagggcgcgctgcacctggacgacgtcctggcgcgccgcctg
cgggtctccatcgagaccttcgaccgcggcgtcggcgccgccgagcccaccgcgcgcctc
atcgccccggtcctgggctggaccgaggagcagatcgcgcgcgaggtggagcactacgtg
gcgcgggtcgccgcggagcgggagtcccaggagcagcccgacgacgccaccgcggacgcc
gcgcggctcggcgcgccggacatcgtgccggtgaagtag

DBGET integrated database retrieval system