KEGG   Catenulispora acidiphila: Caci_1403Help
Entry
Caci_1403         CDS       T00967                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K08884  serine/threonine protein kinase, bacterial [EC:2.7.11.1]
Organism
cai  Catenulispora acidiphila
Brite
KEGG Orthology (KO) [BR:cai00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cai01001]
    Caci_1403
Enzymes [BR:cai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Caci_1403
Protein kinases [BR:cai01001]
 Serine/threonine kinases: Other
  Bacterial family
   Caci_1403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kdo DUF3915 APH
Motif
Other DBs
NCBI-ProteinID: ACU70326
UniProt: C7Q8R1
LinkDB All DBs
Position
1593840..1595768
Genome map
AA seq 642 aa AA seqDB search
MGRAIGSRYELDDEIGRGAFGAVWRGRVRATGEAVAIKVLLEEFAADADVVTRFLRERAA
LVGLNHRSLVRLRDLVVEGDILALVMQLVEGPDLKKYLAGRGRLAPDEAGLLVAEVAEGM
AVAHSAGIVHRDIKPANVLLEQADGGLRPLLTDFGIARIADAPSVTRTHQVVGTPYYLAP
EVVAGKKATPAADVYAAGIMVYELITGHPVFRGPDAVSVFRQHMNTVPERPAEIPQRLWP
VIAAALVKEPEARPSATVLAAQLRAAIGRSVEGPDGEPTHHLPVEGQYGTLRLPPMGLAA
AGAAASGDSSQPGSSGQGSAASASAGAPTTALPAVSPAAAAAAAKAASAAASAIEPTVPV
VRPAASSAPLPQRAARMDGKIAGWDAPSEPDAIGAGVSRRPAEPGKVPGWDAPSDPDAIG
AGVSRRANSPQQPLPPQMQRQIEQLHKERQQESAPSHQQRLASYPPQPQFAPQGYQQPGP
QGYQQPAPGQPYPAQNQGYQPTQFQGSVPAPPRPVAQAPTHQQRQAPPRERERERDRERE
RDRDREPSRPPVQKTVVKRRRGMPLGCLVKLAILALIGFGIYTGVNWAMAKVNGIHHDLN
NWVSREWHVIAQKIDLEKKKAVPKIPGPSDLPTSFPGSVTTP
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
gtgggcagggcgatcggaagcaggtacgagctcgacgacgagatcggccgcggtgcgttc
ggcgcggtctggcgcggccgcgtgcgcgcgaccggcgaggccgtcgccatcaaggtgctc
ctcgaggagttcgcagccgacgccgacgtggtgacgcggttcctgcgcgagcgcgcggcg
ctggtcggtctgaaccaccgctccctggtgcggctgcgcgacctggtcgtcgagggcgac
atcctggcgctggtgatgcagttggtcgagggcccggacctgaagaagtacctggccggg
cgcgggcgcctggcgccggacgaggccgggctgctggtcgccgaggtcgccgagggcatg
gccgtggcgcactcggccggcatcgtgcaccgcgacatcaagcccgccaacgtgctgctg
gagcaggccgacggcggtctgcggccgctgctgaccgacttcggcatcgcccggatcgcc
gacgcgccctcggtgacccgcacccaccaggtcgtcggcaccccctactacctggcgccg
gaggtggtggccgggaagaaggccacgccggccgccgacgtgtacgccgccggcatcatg
gtctacgagctgatcaccggccacccggtcttccgcggcccggacgcggtcagcgtcttc
cgccagcacatgaacaccgtcccggagcgtcccgccgagatcccgcagcggctgtggccg
gtcatcgccgcggcgctggtcaaggagccggaggcgcggccctcggcgaccgtgctggcc
gctcagctgcgggccgccatcgggcgcagcgtggagggcccggacggcgagcccacgcac
cacctgccggtggaggggcagtacgggacgctgcgcctgccgccgatgggcctggccgcc
gccggcgccgccgcctcgggtgactcctcgcagcccggctcctccggccagggctcggcc
gcctcggcgtcggccggcgccccgaccaccgcgttgccggccgtctccccggctgcggcc
gcggcagctgccaaggcggcctccgcagccgcctcggccatcgagccgaccgtcccggtg
gtccgccccgccgcgtcctccgcgccgctcccgcagcgcgcggcgcggatggacggcaag
atcgccggctgggacgcgccctcggagccggacgccataggagccggcgtctcccgccgc
cccgccgagcccggcaaggtccccggctgggacgccccctcggaccccgacgcgatcggc
gccggcgtctcccgccgcgccaacagcccgcagcagccgctcccgccgcagatgcagcgc
cagatcgagcagctccacaaggagcgccagcaggagtcggcgccgtcccaccagcagcgc
ctggcctcctacccgccgcagccgcagttcgccccgcagggctaccagcagcccggtccc
cagggctaccagcagccggcgcccggccagccctacccggcgcagaaccagggctatcag
cccacgcagttccagggcagcgtcccggcgccgccgcggccggttgcccaggcgccgacc
catcagcagcgccaggcgccgccgcgcgagcgggaacgggagcgggaccgcgaacgggag
cgcgaccgagaccgcgagccctcccgcccgccggtccagaagacggtcgtcaagcgccgc
cgcggcatgccgctgggctgtctggtcaagctcgcgatcctcgccctgatcgggttcggc
atctacaccggtgtcaactgggccatggcgaaggtcaacggcatccaccacgatctgaac
aactgggtctcgcgcgaatggcatgtgatcgcgcagaagatcgacctggagaagaagaag
gccgtgccgaagatcccgggcccgtcggacctcccgacgtccttcccggggtcggtcacc
acaccctga

DBGET integrated database retrieval system