KEGG   Catenulispora acidiphila: Caci_2132Help
Entry
Caci_2132         CDS       T00967                                 

Definition
(GenBank) Aldehyde Dehydrogenase
Organism
cai  Catenulispora acidiphila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ACU71051
UniProt: C7QHM6
LinkDB All DBs
Position
2417877..2419343
Genome map
AA seq 488 aa AA seqDB search
MGTVTEHGKLFIGGSYVDPATTAKLEMISPVTEEVFGRTPEASPADMDRAVAAARHAFDE
GPWPRMAVAERVEILRRLRDRYEARADELAKLISSETGSPYSWSILAQVWAPIMIWDYFL
GLATEYPWEELRQGMLGPTIVRSEPVGVAAGIVAWNVPQFITVSKIAPALVAGCAVVVKP
SPETALDSYLLADMALEAGLPEGVLNIVPAGRENSAYLAAHPGLDKIAFTGSTAGGKAVL
AAAGANLTRVTLELGGKSAAIILPDADLSTAIPGLLPNSYMNNGQACVAQTRVLVQRDRY
AKTVEAMAEAVKALRTGDPLDPETQIGPLVAERQRDRVESYIAKGIGEGARVVVGGGRPA
DLPKGWFVEPTLFADVDNRMVIAQEEIFGPVVAMIPYTDEADAVRIANDSDYGLSGSVWS
ADVEHGLDVARRVRTGNYGVNTFGMEFNSPFGGFKQSGVGREFGPEGLRAYLETKTVHLP
SGYTPEGF
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccgtgaccgagcacgggaaactgttcatcggcggctcctacgtcgacccggcc
acgaccgcgaagctggagatgatctcgccggtcaccgaggaggtgttcggccgcacgccc
gaggcctcgccggcggacatggaccgcgcggtcgccgccgcccgccacgccttcgacgag
ggaccgtggccgcggatggcggtggccgagcgcgtggagatcctgcgccggctgcgcgac
cggtacgaggcgcgcgcggacgaattggccaagctgatcagctccgagaccggatcgccg
tactcctggtcgatcctggcgcaggtgtgggcgccgatcatgatctgggactacttcctg
gggctggccacggagtacccgtgggaggaactgcggcagggcatgctcggtccgaccatc
gtgcgcagcgagccggtgggggtcgcggcggggatcgtggcgtggaacgtgccgcagttc
atcaccgtgagcaagatcgcgccggcgctcgtggcgggctgcgcggtggtggtcaagccg
tcgccggagaccgcgctggactcgtatctgctcgctgatatggcccttgaggccgggctg
ccggagggcgtgctgaacatcgtgccggcggggcgcgagaacagcgcgtatctcgcggcg
catccggggctcgacaagatcgccttcaccggctcgacggccggcggcaaggcggtcctg
gccgccgccggcgcgaacctgacgcgcgtgacgctggaactcggcgggaagtccgcggcg
atcatcctgccggacgcggatctgagtactgcgattcccggactgctgccgaattcgtat
atgaacaacggacaggcatgtgttgcccagacacgggttctggtgcagcgcgatcggtac
gccaagaccgtcgaggcgatggcggaggctgtcaaggcactgagaaccggcgacccgctc
gaccccgagacgcagatcggtcctctggtcgccgagcggcagcgcgatcgagtggagtcc
tatatcgccaaggggatcggcgagggcgcgcgggtggtcgtcggcggcgggcgtccggcg
gatctgcccaaggggtggttcgtcgagccgacgctgttcgcggacgtcgacaaccgcatg
gtgatcgcgcaggaggagatcttcggtccggtcgtcgcgatgatcccgtacaccgacgag
gccgacgcggtgcggatcgccaacgattccgattacgggctctcgggatcggtgtggtcg
gcggacgtggagcacgggctggacgtggcgcggcgcgtgcgaaccggcaactacggcgtc
aacaccttcgggatggagttcaattcgcccttcggcgggttcaagcagtccggggtcggc
agggagttcgggcccgagggcttgcgggcatatctggaaacgaagaccgtgcacttgccg
agcggctatacccctgaagggttttga

DBGET integrated database retrieval system