KEGG   Catenulispora acidiphila: Caci_3481Help
Entry
Caci_3481         CDS       T00967                                 

Definition
(GenBank) Catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
cai  Catenulispora acidiphila
Pathway
cai00380  Tryptophan metabolism
cai00630  Glyoxylate and dicarboxylate metabolism
cai01110  Biosynthesis of secondary metabolites
cai01130  Biosynthesis of antibiotics
cai01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Caci_3481
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    Caci_3481
Enzymes [BR:cai01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     Caci_3481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: ACU72387
UniProt: C7Q967
LinkDB All DBs
Position
3872175..3874337
Genome map
AA seq 720 aa AA seqDB search
MAVGPATAGSGADREDSKDAQLETVRAHPAQDVVTTDQGVRIDDTDNSLRAGERGPTLLE
DFQAREKLTHFDHERIPERVVHARGSAAYGYFECYEPLTELTCADFLSEAGLRTPVFVRF
STVQGPRGSADTVRDVRGFATKFYTREGNYDLVGNNMPVFFIQDAIKFPDFVHAVKPEPH
NEMPTGGTAHDTFWDFCSLQPESTHMLMWAMSDRAIPRSLRMMQGFGVHTFRFVTAEGRG
TFVKFHWRPKLGVASQVWDEAQLTAGKDPDFHRRDLWEAIESGSYPEWELGVQLVAEEDE
SRFDFDILDATKLIPEELVPVKVIGRMVLDRNPENFFAETEQAAFHTANIVPGIDFSNDP
LLQGRNFSYLDTQLIRLGGPNFSQLPVNRPVADVHTNHRDGYGQQVIHRGVSYAPNSLSG
NNPHQAGQERQPGVFKHYQQRVDGEAIRKRSESFSDHYSQATLFWNSMADWERQHIVDAF
RFELGKVETAEIRERMVGNLTHVDAGLARQVAEGLGMELPEPGDDAPRRGDQASPAASPA
LSQDNLLPGDPSTRKVALLAADGVDVALVGDLVAQLRERGVTAEVVGLHGGALSGQSGEV
STIGVDKALPTTASVLYDAVLLGGGEQSVQAVGANTDARRFVAEAYRHGKPIGALGPGIG
LLTDVTGVTGEVGADLNGEEPRSQQGLVIAASTEGGVDGFIEAFAAALSAHRFFGRESAS
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgggcccagcgaccgcgggcagcggagcagaccgtgaagacagcaaggacgcc
cagctcgaaacggtcagggctcacccggcccaggacgtggtcacgaccgaccagggcgtc
cggatcgacgacacggacaactccctgcgcgccggcgaacgcggtccgacgctgctggag
gactttcaggcgcgggagaagctcacccatttcgaccacgagcgcatccccgagcgtgtg
gtgcacgcccggggctctgcggcgtacggctacttcgagtgctacgaacccctgaccgag
ctcacgtgtgccgacttcctgtccgaggccgggctgcgcacgccggtgttcgtgcggttc
tccaccgtgcagggaccgcgcggctcggccgacaccgtgcgggacgtgcgcgggttcgcc
acgaagttctacacccgcgagggcaactacgacctggtcggcaacaacatgccggtgttc
ttcatccaggacgcgatcaagttcccggacttcgtgcacgcggtgaagcccgagccgcac
aacgagatgccgaccggcggtaccgcgcacgacaccttctgggacttctgctccctgcag
ccggaatccacgcacatgctgatgtgggccatgtcggaccgggcgatcccgcgcagcctg
cggatgatgcaggggttcggcgtgcacaccttccgattcgtcaccgccgagggccgcggc
acgttcgtgaagttccactggcggcccaagctcggcgtcgcctcccaggtctgggacgag
gcgcagctgaccgccgggaaggaccccgacttccaccgccgcgacctgtgggaggcgatc
gagtccggcagctacccggagtgggagctcggcgtgcagctggtggccgaggaagacgag
tcgcgcttcgacttcgacatcctggacgccacgaagctgattcccgaagagctggtcccg
gtcaaggtgatcggccgcatggtcctggaccgcaaccccgagaacttcttcgccgagacc
gaacaggccgccttccacaccgccaacatcgtgcccggcatcgacttctccaacgacccc
cttctccagggccgcaacttctcctacctggacacgcagctgatccggctcggcggtccc
aacttctcccagctcccggtcaaccgcccggtcgccgacgtgcacaccaaccaccgcgac
ggctacggccagcaggtcatccaccgcggcgtcagctacgcgccgaactccctgagcggg
aacaacccgcaccaggccggccaggagcggcagcccggcgtcttcaagcactaccagcag
cgcgtcgacggcgaggccatccgcaagcgcagcgagagcttctccgaccactacagccag
gccacgctgttctggaacagcatggccgactgggagcggcagcacatcgtcgacgcgttc
cgcttcgagctcggcaaggtcgagacggcggagatccgcgaacgcatggtcggcaacctc
acgcacgtcgacgccgggctggcgcggcaggtcgccgaaggactggggatggagctgccg
gagccgggcgacgacgccccgcgccgcggcgaccaagcctccccggcggcgtccccggcg
ctgagtcaggacaacctgctgcccggcgatccgagcacccgcaaggtcgcgctgctcgcc
gccgacggcgtcgacgtggcgctcgtcggcgacctcgtcgcgcagctgcgggagcgcggg
gtcaccgccgaagtcgtcggtctgcacggcggagcgctgtcggggcaaagcggcgaggtc
agcaccatcggcgtggacaaggcgctgcccacgaccgcctcggtcctgtacgacgcggtg
ctgctgggcggcggcgagcagtccgtccaagccgtcggcgcgaacaccgacgcccggcgc
ttcgtcgcggaggcctaccgccacggcaagccgatcggcgcgctgggcccgggaatcggc
ctcctgaccgacgtgaccggcgtgaccggcgaggtcggagccgacctgaacggcgaggag
ccgcgctctcagcagggactggtcatcgccgcgtcgaccgagggcggggtggacggtttc
atcgaggcgttcgccgccgcgctgtccgcgcaccgcttcttcggacgcgaatcagcaagc
tga

DBGET integrated database retrieval system